Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4S9P3

Protein Details
Accession A0A1E4S9P3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
68-93EESWGWGKKTRKRVKRQEKLLQEALEHydrophilic
NLS Segment(s)
PositionSequence
75-83KKTRKRVKR
Subcellular Location(s) nucl 12.5, cyto_nucl 10.5, mito 7, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011431  Trafficking_Pga2  
Pfam View protein in Pfam  
PF07543  PGA2  
Amino Acid Sequences IQSLIEQIVNIDLKHAIRLVVIIGGYWFLRTQLNKFLANRQLQGQLEESQTEQQQSNIERLVENPEHEESWGWGKKTRKRVKRQEKLLQEALESAAAGDVDDDEIEELLQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.11
4 0.1
5 0.1
6 0.1
7 0.09
8 0.08
9 0.07
10 0.06
11 0.07
12 0.07
13 0.07
14 0.06
15 0.06
16 0.1
17 0.11
18 0.14
19 0.21
20 0.24
21 0.28
22 0.29
23 0.34
24 0.38
25 0.39
26 0.38
27 0.33
28 0.34
29 0.31
30 0.31
31 0.27
32 0.22
33 0.2
34 0.19
35 0.17
36 0.14
37 0.14
38 0.14
39 0.12
40 0.1
41 0.12
42 0.13
43 0.13
44 0.13
45 0.12
46 0.11
47 0.11
48 0.16
49 0.15
50 0.14
51 0.15
52 0.16
53 0.15
54 0.16
55 0.15
56 0.11
57 0.17
58 0.2
59 0.18
60 0.22
61 0.29
62 0.36
63 0.47
64 0.56
65 0.59
66 0.67
67 0.78
68 0.84
69 0.88
70 0.91
71 0.9
72 0.89
73 0.87
74 0.82
75 0.71
76 0.6
77 0.51
78 0.41
79 0.31
80 0.22
81 0.14
82 0.08
83 0.07
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.05
90 0.05
91 0.05