Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S6C3

Protein Details
Accession A0A1E4S6C3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
147-181NVEEEKSEKKEKKEKKEKKEKKEKKEKKHKKHKKEBasic
NLS Segment(s)
PositionSequence
152-181KSEKKEKKEKKEKKEKKEKKEKKHKKHKKE
Subcellular Location(s) nucl 16.5, mito_nucl 13.666, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013239  RNA_polI_Rpa14  
Pfam View protein in Pfam  
PF08203  RNA_polI_A14  
Amino Acid Sequences MSQVRPKRIAQSAVNTPITTHLNSSVSLQGKEAVERFLTAFLDDEEQRQVGQKVLNSNNTSVISQLKRIQRDLRGLPSEGSSVMRASTPSAGTAVNSKKHKRFDEEEVSVGVKEEATEEAKEEVQEDEEDKMDVDEPVEENVEEEKNVEEEKSEKKEKKEKKEKKEKKEKKEKKHKKHKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.51
3 0.44
4 0.41
5 0.39
6 0.31
7 0.24
8 0.21
9 0.2
10 0.2
11 0.22
12 0.24
13 0.24
14 0.23
15 0.22
16 0.22
17 0.22
18 0.24
19 0.22
20 0.18
21 0.15
22 0.16
23 0.16
24 0.14
25 0.13
26 0.11
27 0.11
28 0.09
29 0.13
30 0.12
31 0.13
32 0.13
33 0.13
34 0.12
35 0.14
36 0.14
37 0.13
38 0.15
39 0.16
40 0.22
41 0.26
42 0.32
43 0.31
44 0.31
45 0.32
46 0.31
47 0.29
48 0.22
49 0.23
50 0.18
51 0.19
52 0.25
53 0.27
54 0.28
55 0.31
56 0.35
57 0.34
58 0.4
59 0.4
60 0.41
61 0.38
62 0.36
63 0.34
64 0.3
65 0.26
66 0.2
67 0.17
68 0.11
69 0.09
70 0.08
71 0.08
72 0.07
73 0.07
74 0.08
75 0.07
76 0.07
77 0.08
78 0.07
79 0.07
80 0.12
81 0.14
82 0.19
83 0.24
84 0.29
85 0.34
86 0.4
87 0.43
88 0.44
89 0.46
90 0.48
91 0.52
92 0.49
93 0.44
94 0.39
95 0.37
96 0.3
97 0.26
98 0.17
99 0.09
100 0.06
101 0.06
102 0.06
103 0.08
104 0.08
105 0.09
106 0.1
107 0.11
108 0.11
109 0.11
110 0.09
111 0.09
112 0.1
113 0.1
114 0.1
115 0.1
116 0.1
117 0.09
118 0.09
119 0.08
120 0.08
121 0.07
122 0.07
123 0.07
124 0.08
125 0.09
126 0.08
127 0.08
128 0.1
129 0.1
130 0.09
131 0.09
132 0.09
133 0.1
134 0.1
135 0.1
136 0.09
137 0.12
138 0.19
139 0.26
140 0.35
141 0.39
142 0.47
143 0.57
144 0.66
145 0.75
146 0.79
147 0.82
148 0.84
149 0.9
150 0.92
151 0.94
152 0.95
153 0.94
154 0.94
155 0.95
156 0.95
157 0.95
158 0.96
159 0.96
160 0.96
161 0.97