Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1FYE8

Protein Details
Accession C1FYE8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
242-264SAYIKGKEEKARREKARKEKAFVBasic
NLS Segment(s)
PositionSequence
224-229KADKKW
245-262IKGKEEKARREKARKEKA
274-311PRGGRGGDSRGRGRGGDRGGRGGGRGRGGEFRGGTPRG
Subcellular Location(s) cyto 13.5, cyto_nucl 11, nucl 5.5, mito 3, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039764  HABP4/SERBP1  
IPR006861  HABP4_PAIRBP1-bd  
IPR019084  Stm1-like_N  
Gene Ontology GO:0003723  F:RNA binding  
KEGG pbn:PADG_00824  -  
Pfam View protein in Pfam  
PF09598  Stm1_N  
Amino Acid Sequences MFCGVVENDANIADPVFLNPSPTKQNLYELLGNDPEEDSDREPSPPTSAVDKTGPRHGKRDGLSQPPRASNQTFARSSNRGGRGGRYGGNEQAFRDREAGSRSNRGRPVDGPHQHIPTGVVKNRDDRGHLLRGDRTNRSDRTVTSKQVEQGWGSNAGDSAWKDEQAGEAIAKSEEKGAEANVAEADAEPEERVKSYDEYLAEQAEQRRQDLGVKEARKPNEGVKADKKWATAKELKRDEDESAYIKGKEEKARREKARKEKAFVEVDMRFIEQPRGGRGGDSRGRGRGGDRGGRGGGRGRGGEFRGGTPRGGASRVNPTGPSVRVDEKNFPALGGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.12
4 0.12
5 0.16
6 0.17
7 0.21
8 0.27
9 0.29
10 0.33
11 0.31
12 0.36
13 0.36
14 0.4
15 0.4
16 0.36
17 0.37
18 0.34
19 0.33
20 0.28
21 0.24
22 0.19
23 0.18
24 0.19
25 0.17
26 0.19
27 0.19
28 0.2
29 0.22
30 0.22
31 0.23
32 0.23
33 0.23
34 0.24
35 0.24
36 0.27
37 0.3
38 0.35
39 0.34
40 0.42
41 0.49
42 0.46
43 0.51
44 0.51
45 0.53
46 0.5
47 0.56
48 0.53
49 0.55
50 0.6
51 0.62
52 0.63
53 0.59
54 0.6
55 0.55
56 0.5
57 0.47
58 0.47
59 0.46
60 0.44
61 0.42
62 0.45
63 0.43
64 0.45
65 0.46
66 0.43
67 0.4
68 0.39
69 0.39
70 0.39
71 0.39
72 0.39
73 0.34
74 0.32
75 0.32
76 0.35
77 0.32
78 0.28
79 0.33
80 0.3
81 0.27
82 0.27
83 0.23
84 0.22
85 0.27
86 0.31
87 0.27
88 0.35
89 0.37
90 0.43
91 0.47
92 0.46
93 0.44
94 0.41
95 0.45
96 0.46
97 0.47
98 0.47
99 0.46
100 0.46
101 0.43
102 0.4
103 0.35
104 0.31
105 0.33
106 0.29
107 0.29
108 0.29
109 0.34
110 0.37
111 0.36
112 0.32
113 0.3
114 0.32
115 0.33
116 0.34
117 0.32
118 0.33
119 0.38
120 0.4
121 0.39
122 0.39
123 0.39
124 0.39
125 0.4
126 0.37
127 0.32
128 0.37
129 0.38
130 0.37
131 0.33
132 0.34
133 0.32
134 0.33
135 0.33
136 0.24
137 0.22
138 0.19
139 0.18
140 0.16
141 0.14
142 0.11
143 0.1
144 0.11
145 0.09
146 0.11
147 0.1
148 0.1
149 0.1
150 0.1
151 0.1
152 0.09
153 0.1
154 0.06
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.06
163 0.06
164 0.06
165 0.08
166 0.07
167 0.08
168 0.06
169 0.06
170 0.06
171 0.05
172 0.06
173 0.04
174 0.04
175 0.04
176 0.05
177 0.05
178 0.05
179 0.06
180 0.07
181 0.08
182 0.1
183 0.13
184 0.13
185 0.15
186 0.15
187 0.15
188 0.14
189 0.15
190 0.16
191 0.18
192 0.18
193 0.16
194 0.16
195 0.16
196 0.2
197 0.19
198 0.22
199 0.25
200 0.27
201 0.33
202 0.38
203 0.39
204 0.37
205 0.37
206 0.36
207 0.38
208 0.39
209 0.39
210 0.41
211 0.45
212 0.47
213 0.48
214 0.45
215 0.41
216 0.41
217 0.42
218 0.43
219 0.44
220 0.5
221 0.54
222 0.54
223 0.53
224 0.52
225 0.47
226 0.41
227 0.37
228 0.29
229 0.26
230 0.26
231 0.23
232 0.22
233 0.24
234 0.27
235 0.33
236 0.38
237 0.45
238 0.52
239 0.62
240 0.7
241 0.76
242 0.8
243 0.83
244 0.87
245 0.84
246 0.79
247 0.75
248 0.73
249 0.67
250 0.58
251 0.54
252 0.43
253 0.39
254 0.34
255 0.3
256 0.23
257 0.2
258 0.22
259 0.18
260 0.19
261 0.2
262 0.22
263 0.21
264 0.22
265 0.23
266 0.29
267 0.32
268 0.36
269 0.36
270 0.36
271 0.37
272 0.36
273 0.36
274 0.34
275 0.35
276 0.37
277 0.35
278 0.35
279 0.36
280 0.36
281 0.35
282 0.34
283 0.31
284 0.27
285 0.26
286 0.25
287 0.28
288 0.29
289 0.33
290 0.28
291 0.28
292 0.32
293 0.32
294 0.3
295 0.26
296 0.28
297 0.25
298 0.26
299 0.24
300 0.21
301 0.3
302 0.33
303 0.33
304 0.31
305 0.33
306 0.36
307 0.36
308 0.35
309 0.3
310 0.34
311 0.38
312 0.42
313 0.46
314 0.45
315 0.49
316 0.46
317 0.41