Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H5C4E5

Protein Details
Accession A0A0H5C4E5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-118DSDPAKKAKKEMRLRNKKKIKMNNFIAQMHydrophilic
NLS Segment(s)
PositionSequence
94-110AKKAKKEMRLRNKKKIK
Subcellular Location(s) mito 25.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFRFVARRTLFTSSILRNSTAQATTATTASNAAKETAASTVTVKSSCKAGTSLNLKVKKSGEDPVALEDSEYPEWLWTVLDPKAQQAKLDSDPAKKAKKEMRLRNKKKIKMNNFIAQM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.38
3 0.35
4 0.31
5 0.31
6 0.31
7 0.25
8 0.22
9 0.17
10 0.17
11 0.17
12 0.16
13 0.14
14 0.11
15 0.12
16 0.12
17 0.12
18 0.11
19 0.1
20 0.1
21 0.1
22 0.1
23 0.09
24 0.09
25 0.08
26 0.09
27 0.09
28 0.1
29 0.11
30 0.11
31 0.1
32 0.12
33 0.12
34 0.12
35 0.12
36 0.11
37 0.17
38 0.21
39 0.27
40 0.32
41 0.36
42 0.35
43 0.37
44 0.37
45 0.33
46 0.3
47 0.28
48 0.22
49 0.19
50 0.2
51 0.19
52 0.19
53 0.17
54 0.15
55 0.11
56 0.12
57 0.11
58 0.1
59 0.08
60 0.07
61 0.07
62 0.07
63 0.07
64 0.05
65 0.08
66 0.08
67 0.11
68 0.12
69 0.16
70 0.23
71 0.23
72 0.24
73 0.24
74 0.28
75 0.27
76 0.35
77 0.34
78 0.31
79 0.38
80 0.44
81 0.48
82 0.44
83 0.5
84 0.49
85 0.56
86 0.63
87 0.67
88 0.72
89 0.76
90 0.85
91 0.88
92 0.91
93 0.89
94 0.89
95 0.89
96 0.88
97 0.87
98 0.86