Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H5C2H0

Protein Details
Accession A0A0H5C2H0   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
155-186FGPHKNKAPRILSKGRKFERARGKRNSRGFKVBasic
NLS Segment(s)
PositionSequence
154-186GFGPHKNKAPRILSKGRKFERARGKRNSRGFKV
Subcellular Location(s) mito 17, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR021132  Ribosomal_L18/L18-A/B/e_CS  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
PROSITE View protein in PROSITE  
PS01106  RIBOSOMAL_L18E  
Amino Acid Sequences MGRDHFTKQHARSGHREAPKSDNVYLKLLVKLYSFLARRTDAPFNKVVLKSLFLSKINRPPVSVSRISRALSQKGAADKTIVVVGTVTDDNRIFEFPKATVAALRFTAGARAKILKAGGEAITLDQLATRAPKGQNTLLVRGPRNSREAVRHFGFGPHKNKAPRILSKGRKFERARGKRNSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.62
3 0.64
4 0.6
5 0.61
6 0.63
7 0.6
8 0.55
9 0.52
10 0.47
11 0.45
12 0.43
13 0.38
14 0.33
15 0.29
16 0.26
17 0.2
18 0.19
19 0.18
20 0.23
21 0.21
22 0.21
23 0.24
24 0.24
25 0.26
26 0.3
27 0.37
28 0.33
29 0.36
30 0.36
31 0.34
32 0.39
33 0.37
34 0.35
35 0.27
36 0.26
37 0.24
38 0.25
39 0.27
40 0.23
41 0.26
42 0.29
43 0.36
44 0.41
45 0.4
46 0.37
47 0.37
48 0.4
49 0.43
50 0.43
51 0.37
52 0.34
53 0.37
54 0.36
55 0.38
56 0.37
57 0.33
58 0.28
59 0.27
60 0.26
61 0.26
62 0.26
63 0.2
64 0.17
65 0.14
66 0.13
67 0.13
68 0.1
69 0.06
70 0.05
71 0.05
72 0.06
73 0.06
74 0.06
75 0.06
76 0.06
77 0.07
78 0.08
79 0.09
80 0.08
81 0.08
82 0.09
83 0.08
84 0.1
85 0.1
86 0.1
87 0.11
88 0.11
89 0.11
90 0.1
91 0.1
92 0.09
93 0.08
94 0.13
95 0.13
96 0.13
97 0.13
98 0.14
99 0.14
100 0.15
101 0.15
102 0.11
103 0.1
104 0.11
105 0.1
106 0.09
107 0.09
108 0.07
109 0.08
110 0.07
111 0.06
112 0.05
113 0.05
114 0.05
115 0.06
116 0.06
117 0.11
118 0.12
119 0.15
120 0.19
121 0.21
122 0.28
123 0.3
124 0.33
125 0.33
126 0.38
127 0.37
128 0.38
129 0.41
130 0.37
131 0.38
132 0.37
133 0.36
134 0.39
135 0.42
136 0.45
137 0.42
138 0.41
139 0.38
140 0.41
141 0.45
142 0.44
143 0.46
144 0.44
145 0.49
146 0.52
147 0.55
148 0.58
149 0.59
150 0.59
151 0.62
152 0.67
153 0.7
154 0.75
155 0.81
156 0.77
157 0.79
158 0.75
159 0.75
160 0.76
161 0.77
162 0.77
163 0.77
164 0.82
165 0.82
166 0.88