Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S3Y9

Protein Details
Accession A0A1E4S3Y9    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-41VCLNCKTRKIKCDKKRPACSNCVKCNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 11.333, nucl 11, mito 10.5, cyto_nucl 8.833, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MEAADKPKKRQRMSVVCLNCKTRKIKCDKKRPACSNCVKCNVGHLCEYEPPHWVTRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.74
3 0.72
4 0.72
5 0.69
6 0.61
7 0.56
8 0.55
9 0.51
10 0.51
11 0.54
12 0.61
13 0.65
14 0.73
15 0.79
16 0.83
17 0.88
18 0.89
19 0.85
20 0.84
21 0.84
22 0.82
23 0.78
24 0.74
25 0.65
26 0.55
27 0.57
28 0.52
29 0.44
30 0.37
31 0.32
32 0.28
33 0.32
34 0.36
35 0.28
36 0.28
37 0.28