Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RXK4

Protein Details
Accession A0A1E4RXK4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
14-34ASARFRVKKKLKEQEMERNVKHydrophilic
NLS Segment(s)
PositionSequence
9-10KR
15-23SARFRVKKK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
Amino Acid Sequences DEVEQDKKKRNTLASARFRVKKKLKEQEMERNVKLLSDRVATFNERINQLELENACLKSLILEKNEKKSNDLLRSIKEKSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.74
4 0.75
5 0.73
6 0.74
7 0.72
8 0.71
9 0.71
10 0.73
11 0.74
12 0.75
13 0.8
14 0.8
15 0.81
16 0.78
17 0.67
18 0.58
19 0.5
20 0.42
21 0.35
22 0.25
23 0.17
24 0.13
25 0.13
26 0.13
27 0.14
28 0.15
29 0.15
30 0.18
31 0.18
32 0.17
33 0.18
34 0.18
35 0.17
36 0.15
37 0.18
38 0.14
39 0.16
40 0.17
41 0.16
42 0.15
43 0.14
44 0.14
45 0.12
46 0.17
47 0.17
48 0.18
49 0.28
50 0.32
51 0.41
52 0.48
53 0.47
54 0.45
55 0.49
56 0.55
57 0.52
58 0.56
59 0.52
60 0.52
61 0.58