Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S3D0

Protein Details
Accession A0A1E4S3D0    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-45KNTTRVSESKYKRRQENKRQSEKVAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013170  mRNA_splic_Cwf21_dom  
Gene Ontology GO:0005681  C:spliceosomal complex  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08312  cwf21  
CDD cd21372  cwf21_CWC21-like  
Amino Acid Sequences YNGIGLSTARGSGTNGYIQKNTTRVSESKYKRRQENKRQSEKVAKLVTVKDKSLVDRERRREIELRVSELRDELEDQDMDGELIDEKCDQLRQELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.23
4 0.24
5 0.25
6 0.27
7 0.29
8 0.28
9 0.24
10 0.25
11 0.24
12 0.29
13 0.37
14 0.42
15 0.49
16 0.57
17 0.62
18 0.67
19 0.76
20 0.82
21 0.83
22 0.86
23 0.87
24 0.88
25 0.84
26 0.8
27 0.8
28 0.71
29 0.67
30 0.57
31 0.47
32 0.39
33 0.39
34 0.4
35 0.32
36 0.29
37 0.24
38 0.23
39 0.24
40 0.29
41 0.31
42 0.34
43 0.4
44 0.46
45 0.52
46 0.52
47 0.55
48 0.53
49 0.51
50 0.52
51 0.46
52 0.46
53 0.4
54 0.39
55 0.35
56 0.31
57 0.28
58 0.19
59 0.18
60 0.13
61 0.14
62 0.13
63 0.12
64 0.12
65 0.12
66 0.1
67 0.09
68 0.08
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.1
75 0.13
76 0.13