Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4RZM4

Protein Details
Accession A0A1E4RZM4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
12-35NEKFYKKHEKQMGKPKPKTKKESPBasic
NLS Segment(s)
PositionSequence
17-32KKHEKQMGKPKPKTKK
Subcellular Location(s) plas 13, E.R. 8, mito 3, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010580  ER_stress-assoc  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF06624  RAMP4  
Amino Acid Sequences MAIQTPKQRLANEKFYKKHEKQMGKPKPKTKKESPVSTGWIILLAFLIGGGAVLEIIRIFF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.74
4 0.68
5 0.7
6 0.68
7 0.67
8 0.68
9 0.74
10 0.78
11 0.78
12 0.83
13 0.82
14 0.83
15 0.83
16 0.82
17 0.79
18 0.79
19 0.76
20 0.76
21 0.72
22 0.65
23 0.61
24 0.54
25 0.46
26 0.35
27 0.28
28 0.19
29 0.15
30 0.1
31 0.05
32 0.04
33 0.03
34 0.03
35 0.02
36 0.02
37 0.02
38 0.02
39 0.02
40 0.02
41 0.03