Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E4S9Y9

Protein Details
Accession A0A1E4S9Y9    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
80-122PKDLRAKKTRALRRKLTKFEASQVTEKQKKKQLAFPQRKYAIKHydrophilic
NLS Segment(s)
PositionSequence
79-97QPKDLRAKKTRALRRKLTK
108-109KK
Subcellular Location(s) nucl 13.5, cyto_nucl 10.5, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MIILAGLRAYELRTKSKEQLEEQLVSLKQELANLKVQKLTRPSLPKIGTVRKDIARVLTVINLNQREAVRAFYAGKKYQPKDLRAKKTRALRRKLTKFEASQVTEKQKKKQLAFPQRKYAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.39
3 0.46
4 0.5
5 0.48
6 0.54
7 0.52
8 0.49
9 0.45
10 0.44
11 0.37
12 0.32
13 0.29
14 0.21
15 0.16
16 0.18
17 0.19
18 0.16
19 0.23
20 0.24
21 0.24
22 0.27
23 0.28
24 0.28
25 0.32
26 0.32
27 0.31
28 0.36
29 0.38
30 0.42
31 0.43
32 0.43
33 0.45
34 0.5
35 0.46
36 0.43
37 0.45
38 0.38
39 0.39
40 0.34
41 0.29
42 0.22
43 0.19
44 0.16
45 0.14
46 0.13
47 0.12
48 0.15
49 0.14
50 0.13
51 0.15
52 0.14
53 0.13
54 0.13
55 0.14
56 0.1
57 0.11
58 0.13
59 0.14
60 0.19
61 0.19
62 0.24
63 0.31
64 0.32
65 0.4
66 0.45
67 0.48
68 0.54
69 0.63
70 0.68
71 0.68
72 0.72
73 0.7
74 0.74
75 0.77
76 0.76
77 0.75
78 0.74
79 0.77
80 0.81
81 0.83
82 0.8
83 0.78
84 0.71
85 0.69
86 0.67
87 0.6
88 0.56
89 0.54
90 0.56
91 0.57
92 0.59
93 0.6
94 0.6
95 0.64
96 0.64
97 0.67
98 0.68
99 0.71
100 0.78
101 0.79
102 0.81
103 0.8