Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4S2F1

Protein Details
Accession A0A1E4S2F1    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
23-72IKTSKQWVLPPRPRPGRKPNSAGCQQTQKKEPKKSYKKKSDQSKADKAVIHydrophilic
NLS Segment(s)
PositionSequence
35-40PRPGRK
51-61KKEPKKSYKKK
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018287  Hap4_TF_heteromerisation  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF10297  Hap4_Hap_bind  
Amino Acid Sequences MMNSKPMHQSPLNIQSVSTPTVIKTSKQWVLPPRPRPGRKPNSAGCQQTQKKEPKKSYKKKSDQSKADKAVINPIEIALKKIKDENQSLKVELSKLVSDLKALQEQTPDEDDHLIHKKRSESVVDSEEDETSSQISTPSLMSSSSYMSASTSSLDSIKEEQTLKIDDFLTTSFFESSSNSITSDFPPSLPSLRAKKTENAFEFNFLKQESMKQQEVMKNEGYDPLFQSVNPDAMDVDIEFWSWK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.37
3 0.39
4 0.37
5 0.29
6 0.2
7 0.16
8 0.23
9 0.24
10 0.22
11 0.24
12 0.3
13 0.34
14 0.37
15 0.43
16 0.46
17 0.56
18 0.64
19 0.67
20 0.69
21 0.75
22 0.79
23 0.81
24 0.82
25 0.82
26 0.81
27 0.82
28 0.79
29 0.77
30 0.78
31 0.74
32 0.68
33 0.68
34 0.65
35 0.63
36 0.63
37 0.65
38 0.66
39 0.71
40 0.76
41 0.77
42 0.83
43 0.87
44 0.9
45 0.91
46 0.92
47 0.91
48 0.92
49 0.91
50 0.9
51 0.89
52 0.88
53 0.82
54 0.77
55 0.71
56 0.6
57 0.59
58 0.49
59 0.4
60 0.3
61 0.25
62 0.23
63 0.2
64 0.21
65 0.16
66 0.16
67 0.16
68 0.2
69 0.24
70 0.26
71 0.33
72 0.37
73 0.4
74 0.42
75 0.42
76 0.39
77 0.35
78 0.3
79 0.25
80 0.2
81 0.13
82 0.12
83 0.12
84 0.11
85 0.11
86 0.11
87 0.12
88 0.13
89 0.14
90 0.13
91 0.14
92 0.14
93 0.15
94 0.16
95 0.14
96 0.12
97 0.12
98 0.11
99 0.13
100 0.2
101 0.2
102 0.18
103 0.21
104 0.21
105 0.23
106 0.25
107 0.24
108 0.2
109 0.22
110 0.24
111 0.22
112 0.22
113 0.2
114 0.18
115 0.16
116 0.13
117 0.09
118 0.07
119 0.06
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.06
129 0.07
130 0.08
131 0.08
132 0.08
133 0.08
134 0.08
135 0.08
136 0.08
137 0.08
138 0.07
139 0.07
140 0.07
141 0.07
142 0.09
143 0.1
144 0.11
145 0.13
146 0.14
147 0.14
148 0.15
149 0.17
150 0.16
151 0.16
152 0.16
153 0.13
154 0.13
155 0.13
156 0.12
157 0.11
158 0.12
159 0.1
160 0.09
161 0.1
162 0.1
163 0.12
164 0.12
165 0.12
166 0.12
167 0.13
168 0.14
169 0.15
170 0.18
171 0.17
172 0.14
173 0.15
174 0.17
175 0.18
176 0.19
177 0.24
178 0.27
179 0.32
180 0.37
181 0.39
182 0.44
183 0.48
184 0.55
185 0.52
186 0.51
187 0.47
188 0.47
189 0.46
190 0.4
191 0.36
192 0.27
193 0.24
194 0.2
195 0.24
196 0.26
197 0.31
198 0.32
199 0.32
200 0.38
201 0.41
202 0.44
203 0.42
204 0.38
205 0.33
206 0.31
207 0.34
208 0.29
209 0.27
210 0.26
211 0.24
212 0.21
213 0.2
214 0.24
215 0.21
216 0.22
217 0.2
218 0.18
219 0.15
220 0.15
221 0.17
222 0.12
223 0.12
224 0.09