Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E4RXG2

Protein Details
Accession A0A1E4RXG2    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
8-35SSRTPPSSRSLKRRAPEKRAPQRIHPLWHydrophilic
NLS Segment(s)
PositionSequence
16-28RSLKRRAPEKRAP
Subcellular Location(s) mito 12, nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MLCRLYRSSRTPPSSRSLKRRAPEKRAPQRIHPLWSPQSKHTCCEPHMLTPNEGLITTTQSVQWPIPKEPYSRFRRARFQVFYPFRNKLAERATVQLHKRQIYVSALLQKVHLTGMCSSTPSVGDEHVNYVFLAMLPIAQLPSYVLVQGTTQCAARAEKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.71
4 0.7
5 0.71
6 0.73
7 0.79
8 0.81
9 0.8
10 0.81
11 0.83
12 0.84
13 0.86
14 0.83
15 0.82
16 0.82
17 0.78
18 0.73
19 0.65
20 0.62
21 0.6
22 0.63
23 0.58
24 0.54
25 0.59
26 0.55
27 0.54
28 0.54
29 0.5
30 0.44
31 0.48
32 0.43
33 0.4
34 0.47
35 0.46
36 0.4
37 0.36
38 0.35
39 0.27
40 0.25
41 0.18
42 0.1
43 0.1
44 0.1
45 0.1
46 0.09
47 0.1
48 0.11
49 0.11
50 0.15
51 0.16
52 0.17
53 0.22
54 0.23
55 0.26
56 0.3
57 0.39
58 0.42
59 0.48
60 0.53
61 0.53
62 0.6
63 0.63
64 0.65
65 0.59
66 0.55
67 0.56
68 0.53
69 0.53
70 0.49
71 0.45
72 0.38
73 0.38
74 0.35
75 0.29
76 0.29
77 0.29
78 0.25
79 0.26
80 0.27
81 0.3
82 0.32
83 0.32
84 0.33
85 0.3
86 0.29
87 0.27
88 0.27
89 0.23
90 0.24
91 0.22
92 0.24
93 0.24
94 0.23
95 0.23
96 0.21
97 0.19
98 0.17
99 0.14
100 0.09
101 0.09
102 0.12
103 0.12
104 0.13
105 0.13
106 0.13
107 0.12
108 0.12
109 0.11
110 0.1
111 0.12
112 0.11
113 0.14
114 0.14
115 0.14
116 0.13
117 0.12
118 0.11
119 0.09
120 0.08
121 0.05
122 0.05
123 0.05
124 0.05
125 0.05
126 0.05
127 0.05
128 0.05
129 0.08
130 0.08
131 0.08
132 0.08
133 0.08
134 0.09
135 0.11
136 0.13
137 0.12
138 0.13
139 0.13
140 0.16
141 0.17