Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H5C9V8

Protein Details
Accession A0A0H5C9V8    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
29-50VFSIKYRQKKLKELTSRKPFFDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 10, nucl 8.5, cyto 8.5, E.R. 5, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018624  Sec66  
Gene Ontology GO:0031207  C:Sec62/Sec63 complex  
GO:0031204  P:post-translational protein targeting to membrane, translocation  
Pfam View protein in Pfam  
PF09802  Sec66  
Amino Acid Sequences MDEEEMPITKISVYTPLIYVTIMIGALVVFSIKYRQKKLKELTSRKPFFDRNIAKEMYFELVNADEKPNEQVLKAALIRRGAECIKRTLKLKEFTPFMNVLYHKGSISDDLWERFQTAQKVEEIEIQELVQETEKYKKGWVSKFLPLLQEVCLNEALAKKYNGLKDKKVDLLHEWGIKVNDDGTYVFPNQTPHKQTATVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.17
5 0.17
6 0.16
7 0.1
8 0.09
9 0.07
10 0.06
11 0.05
12 0.04
13 0.04
14 0.04
15 0.03
16 0.03
17 0.03
18 0.1
19 0.16
20 0.23
21 0.3
22 0.39
23 0.46
24 0.56
25 0.64
26 0.68
27 0.74
28 0.77
29 0.81
30 0.83
31 0.8
32 0.74
33 0.72
34 0.65
35 0.58
36 0.59
37 0.56
38 0.5
39 0.52
40 0.5
41 0.44
42 0.41
43 0.37
44 0.28
45 0.21
46 0.15
47 0.1
48 0.1
49 0.11
50 0.12
51 0.12
52 0.1
53 0.1
54 0.12
55 0.13
56 0.12
57 0.11
58 0.11
59 0.11
60 0.14
61 0.15
62 0.16
63 0.16
64 0.17
65 0.18
66 0.17
67 0.2
68 0.19
69 0.21
70 0.2
71 0.24
72 0.26
73 0.28
74 0.3
75 0.33
76 0.38
77 0.37
78 0.38
79 0.37
80 0.35
81 0.33
82 0.34
83 0.28
84 0.22
85 0.22
86 0.2
87 0.17
88 0.17
89 0.17
90 0.13
91 0.13
92 0.13
93 0.11
94 0.11
95 0.11
96 0.11
97 0.12
98 0.13
99 0.12
100 0.13
101 0.12
102 0.15
103 0.15
104 0.15
105 0.15
106 0.15
107 0.17
108 0.16
109 0.19
110 0.18
111 0.16
112 0.15
113 0.13
114 0.12
115 0.11
116 0.11
117 0.08
118 0.07
119 0.08
120 0.13
121 0.16
122 0.16
123 0.18
124 0.22
125 0.29
126 0.33
127 0.4
128 0.39
129 0.44
130 0.48
131 0.48
132 0.46
133 0.39
134 0.35
135 0.29
136 0.27
137 0.21
138 0.18
139 0.16
140 0.14
141 0.15
142 0.16
143 0.18
144 0.17
145 0.18
146 0.18
147 0.23
148 0.3
149 0.37
150 0.39
151 0.43
152 0.46
153 0.51
154 0.55
155 0.52
156 0.49
157 0.44
158 0.46
159 0.44
160 0.41
161 0.36
162 0.33
163 0.32
164 0.29
165 0.26
166 0.2
167 0.15
168 0.14
169 0.14
170 0.13
171 0.16
172 0.17
173 0.17
174 0.18
175 0.23
176 0.28
177 0.35
178 0.38
179 0.39
180 0.41