Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H5C1U6

Protein Details
Accession A0A0H5C1U6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAQRVTYRRRNPYNSRSNKIKVHydrophilic
NLS Segment(s)
PositionSequence
106-125KEQAEKEKAAEKKAAKKSKK
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAQRVTYRRRNPYNSRSNKIKVVKTPGGVLRAQHVKKTGTRPKCGDCGVALPGISSLRPREYAQVSKTHKTVSRAYGGSRCANCVKERIVRAFLIEEQKIVKRVLKEQAEKEKAAEKKAAKKSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.82
4 0.77
5 0.77
6 0.75
7 0.71
8 0.67
9 0.67
10 0.64
11 0.57
12 0.57
13 0.51
14 0.47
15 0.41
16 0.34
17 0.31
18 0.35
19 0.35
20 0.32
21 0.31
22 0.31
23 0.35
24 0.45
25 0.49
26 0.47
27 0.53
28 0.56
29 0.56
30 0.58
31 0.54
32 0.45
33 0.36
34 0.31
35 0.25
36 0.21
37 0.17
38 0.12
39 0.11
40 0.1
41 0.09
42 0.08
43 0.08
44 0.08
45 0.11
46 0.11
47 0.15
48 0.18
49 0.22
50 0.23
51 0.3
52 0.34
53 0.34
54 0.34
55 0.33
56 0.33
57 0.33
58 0.35
59 0.3
60 0.31
61 0.29
62 0.31
63 0.31
64 0.32
65 0.34
66 0.29
67 0.29
68 0.27
69 0.28
70 0.27
71 0.27
72 0.28
73 0.28
74 0.32
75 0.33
76 0.33
77 0.31
78 0.31
79 0.3
80 0.29
81 0.29
82 0.25
83 0.22
84 0.22
85 0.24
86 0.25
87 0.24
88 0.24
89 0.22
90 0.27
91 0.36
92 0.42
93 0.46
94 0.52
95 0.62
96 0.63
97 0.61
98 0.57
99 0.56
100 0.51
101 0.48
102 0.47
103 0.43
104 0.48
105 0.58