Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1FYS1

Protein Details
Accession C1FYS1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
68-88AWPWRLQAAKHRKEGRRSRESHydrophilic
NLS Segment(s)
PositionSequence
77-86KHRKEGRRSR
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG pbn:PADG_00947  -  
Amino Acid Sequences MAYVINNAEGFSGRDLKPTFELETVTDLRAETHVATQFKLCRFPSNPTSPVRSLTSRRLILIPSWMQAWPWRLQAAKHRKEGRRSRES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.25
4 0.26
5 0.28
6 0.27
7 0.22
8 0.23
9 0.18
10 0.22
11 0.21
12 0.19
13 0.16
14 0.14
15 0.13
16 0.13
17 0.13
18 0.08
19 0.1
20 0.14
21 0.14
22 0.15
23 0.17
24 0.2
25 0.2
26 0.25
27 0.22
28 0.23
29 0.25
30 0.3
31 0.35
32 0.37
33 0.4
34 0.37
35 0.41
36 0.37
37 0.37
38 0.36
39 0.33
40 0.31
41 0.34
42 0.39
43 0.35
44 0.35
45 0.33
46 0.31
47 0.28
48 0.3
49 0.24
50 0.18
51 0.19
52 0.17
53 0.17
54 0.2
55 0.22
56 0.19
57 0.2
58 0.22
59 0.22
60 0.26
61 0.36
62 0.44
63 0.48
64 0.55
65 0.62
66 0.67
67 0.76
68 0.83