Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QNU6

Protein Details
Accession A0A1E3QNU6   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
131-158SENIMGEEKKKKKKAKKLRKIDLEMEGPBasic
NLS Segment(s)
PositionSequence
139-150KKKKKKAKKLRK
Subcellular Location(s) mito 12.5, cyto_mito 11.166, cyto 8.5, cyto_nucl 8.333, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001328  Pept_tRNA_hydro  
IPR018171  Pept_tRNA_hydro_CS  
IPR036416  Pept_tRNA_hydro_sf  
Gene Ontology GO:0004045  F:aminoacyl-tRNA hydrolase activity  
Pfam View protein in Pfam  
PF01195  Pept_tRNA_hydro  
PROSITE View protein in PROSITE  
PS01196  PEPT_TRNA_HYDROL_2  
Amino Acid Sequences MLFVRTQSYMNVSGAPISRIWNAVKQLKLPQVSSLVVIHDELSIPVGKVQVRKQFTSARGHNGLRSISENIGGGYTKIGIGIGKPTNGEVADYVLTRFNKQDLATIEMDTIPQVVSIIEDMKMGRYIYEVSENIMGEEKKKKKKAKKLRKIDLEMEGPGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.16
4 0.16
5 0.17
6 0.18
7 0.2
8 0.22
9 0.27
10 0.32
11 0.33
12 0.34
13 0.4
14 0.43
15 0.44
16 0.4
17 0.36
18 0.33
19 0.31
20 0.3
21 0.23
22 0.18
23 0.15
24 0.15
25 0.13
26 0.09
27 0.09
28 0.07
29 0.08
30 0.07
31 0.07
32 0.07
33 0.09
34 0.11
35 0.14
36 0.21
37 0.27
38 0.31
39 0.32
40 0.35
41 0.39
42 0.42
43 0.46
44 0.43
45 0.42
46 0.43
47 0.43
48 0.4
49 0.36
50 0.32
51 0.25
52 0.24
53 0.19
54 0.14
55 0.14
56 0.13
57 0.11
58 0.11
59 0.09
60 0.07
61 0.05
62 0.05
63 0.04
64 0.04
65 0.04
66 0.03
67 0.04
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.1
74 0.1
75 0.1
76 0.06
77 0.07
78 0.07
79 0.07
80 0.08
81 0.11
82 0.11
83 0.12
84 0.12
85 0.12
86 0.14
87 0.14
88 0.18
89 0.16
90 0.21
91 0.21
92 0.2
93 0.2
94 0.17
95 0.17
96 0.12
97 0.1
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.06
105 0.06
106 0.06
107 0.07
108 0.08
109 0.1
110 0.09
111 0.09
112 0.09
113 0.1
114 0.11
115 0.16
116 0.15
117 0.15
118 0.18
119 0.18
120 0.17
121 0.2
122 0.19
123 0.18
124 0.27
125 0.35
126 0.42
127 0.52
128 0.61
129 0.67
130 0.79
131 0.86
132 0.88
133 0.9
134 0.92
135 0.94
136 0.94
137 0.91
138 0.86
139 0.82
140 0.74