Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QI90

Protein Details
Accession A0A1E3QI90   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
88-117HMTLARKRRGKGKPKKKDGPPPEDPKSKKKBasic
NLS Segment(s)
PositionSequence
92-117ARKRRGKGKPKKKDGPPPEDPKSKKK
Subcellular Location(s) mito 17.5, mito_nucl 12.5, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MPVVPNTLTPAALRLAQLIKLSCGVFNEVYNPTQIRTGAKYLKRKLKGHVTGSYYTPNSFPSVYDLKKHFPKEIQHRFITNEDKYKLHMTLARKRRGKGKPKKKDGPPPEDPKSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.16
4 0.19
5 0.18
6 0.17
7 0.18
8 0.18
9 0.16
10 0.15
11 0.17
12 0.15
13 0.15
14 0.17
15 0.16
16 0.16
17 0.18
18 0.17
19 0.15
20 0.15
21 0.16
22 0.15
23 0.16
24 0.21
25 0.27
26 0.33
27 0.41
28 0.48
29 0.56
30 0.61
31 0.61
32 0.62
33 0.65
34 0.65
35 0.62
36 0.6
37 0.55
38 0.49
39 0.47
40 0.44
41 0.34
42 0.27
43 0.22
44 0.17
45 0.14
46 0.13
47 0.11
48 0.12
49 0.17
50 0.17
51 0.21
52 0.22
53 0.26
54 0.32
55 0.34
56 0.33
57 0.33
58 0.4
59 0.47
60 0.55
61 0.56
62 0.52
63 0.52
64 0.52
65 0.52
66 0.51
67 0.43
68 0.4
69 0.36
70 0.34
71 0.35
72 0.35
73 0.31
74 0.27
75 0.28
76 0.28
77 0.36
78 0.45
79 0.52
80 0.54
81 0.56
82 0.64
83 0.69
84 0.73
85 0.75
86 0.77
87 0.78
88 0.84
89 0.91
90 0.92
91 0.92
92 0.92
93 0.9
94 0.89
95 0.87
96 0.85
97 0.85