Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GKA6

Protein Details
Accession C1GKA6    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-26PKQTSLRGSKRSRPYPDPKTRPMMSHydrophilic
125-144KSPNACRKRHERLVAKRRGSBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.999, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
KEGG pbn:PADG_07692  -  
Pfam View protein in Pfam  
PF13921  Myb_DNA-bind_6  
Amino Acid Sequences MPKQTSLRGSKRSRPYPDPKTRPMMSNTKTNPSRTPAAAVGATARRPPPAWEHHQTSPSSMPPPRFSMFDRRVVQDCAAPLSPTTPSASSSPSVPWSPHDDKVLMSARALGHGWSQIQKENFHSKSPNACRKRHERLVAKRRGSEWEDERVEKVTRHYHQMRRDIWRPLAEAAGENWEDVEKICLTRGQRNLLPMPTHSSIRRLSSDNESRGSHESHDEEKLRIPNLIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.83
4 0.86
5 0.86
6 0.82
7 0.81
8 0.76
9 0.72
10 0.68
11 0.67
12 0.59
13 0.6
14 0.57
15 0.59
16 0.6
17 0.59
18 0.56
19 0.51
20 0.53
21 0.44
22 0.44
23 0.36
24 0.34
25 0.3
26 0.26
27 0.24
28 0.22
29 0.22
30 0.21
31 0.2
32 0.19
33 0.2
34 0.22
35 0.25
36 0.3
37 0.37
38 0.41
39 0.47
40 0.5
41 0.54
42 0.52
43 0.48
44 0.43
45 0.38
46 0.36
47 0.33
48 0.32
49 0.3
50 0.35
51 0.33
52 0.32
53 0.33
54 0.38
55 0.39
56 0.44
57 0.44
58 0.42
59 0.43
60 0.43
61 0.4
62 0.32
63 0.28
64 0.22
65 0.2
66 0.16
67 0.13
68 0.13
69 0.12
70 0.11
71 0.12
72 0.09
73 0.11
74 0.12
75 0.14
76 0.13
77 0.13
78 0.14
79 0.15
80 0.15
81 0.14
82 0.15
83 0.21
84 0.24
85 0.25
86 0.26
87 0.24
88 0.23
89 0.28
90 0.29
91 0.21
92 0.17
93 0.18
94 0.16
95 0.16
96 0.16
97 0.11
98 0.08
99 0.09
100 0.1
101 0.09
102 0.1
103 0.13
104 0.14
105 0.15
106 0.19
107 0.27
108 0.27
109 0.27
110 0.29
111 0.28
112 0.36
113 0.44
114 0.49
115 0.48
116 0.5
117 0.54
118 0.61
119 0.68
120 0.67
121 0.67
122 0.67
123 0.71
124 0.78
125 0.81
126 0.75
127 0.69
128 0.63
129 0.59
130 0.52
131 0.47
132 0.4
133 0.39
134 0.38
135 0.36
136 0.36
137 0.33
138 0.31
139 0.26
140 0.26
141 0.27
142 0.26
143 0.34
144 0.41
145 0.45
146 0.52
147 0.59
148 0.61
149 0.61
150 0.64
151 0.62
152 0.58
153 0.54
154 0.48
155 0.41
156 0.36
157 0.28
158 0.24
159 0.18
160 0.18
161 0.15
162 0.13
163 0.12
164 0.1
165 0.1
166 0.09
167 0.11
168 0.08
169 0.08
170 0.09
171 0.13
172 0.16
173 0.23
174 0.28
175 0.32
176 0.34
177 0.39
178 0.42
179 0.43
180 0.42
181 0.37
182 0.39
183 0.35
184 0.37
185 0.33
186 0.34
187 0.33
188 0.35
189 0.37
190 0.33
191 0.35
192 0.41
193 0.48
194 0.47
195 0.48
196 0.44
197 0.44
198 0.44
199 0.42
200 0.35
201 0.31
202 0.31
203 0.31
204 0.37
205 0.36
206 0.34
207 0.38
208 0.41
209 0.37