Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QKH2

Protein Details
Accession A0A1E3QKH2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-76RKGRVFVYCKTNKKHKQRQGBasic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:0016020  C:membrane  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MFGTLFRSPAVKQTTQLFGTSVAQTGLVGFMGLNWVRAMKTKTSVKKFCQDCYMVRRKGRVFVYCKTNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.34
4 0.27
5 0.23
6 0.24
7 0.22
8 0.18
9 0.12
10 0.11
11 0.1
12 0.09
13 0.07
14 0.05
15 0.04
16 0.03
17 0.03
18 0.06
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.09
25 0.11
26 0.1
27 0.16
28 0.23
29 0.31
30 0.4
31 0.46
32 0.48
33 0.55
34 0.56
35 0.53
36 0.52
37 0.47
38 0.44
39 0.47
40 0.53
41 0.51
42 0.51
43 0.56
44 0.52
45 0.56
46 0.57
47 0.55
48 0.51
49 0.51
50 0.58
51 0.6
52 0.67
53 0.67
54 0.72
55 0.74
56 0.8