Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QZT6

Protein Details
Accession A0A1E3QZT6   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
135-163ANGTINKEERKRLKKERRKEEKKKKESEEBasic
NLS Segment(s)
PositionSequence
142-160EERKRLKKERRKEEKKKKE
Subcellular Location(s) mito 14.5, mito_nucl 13.5, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013239  RNA_polI_Rpa14  
Pfam View protein in Pfam  
PF08203  RNA_polI_A14  
Amino Acid Sequences MSTGFRPRRPAPSAVTAPTTVHITNSVPLKKEDVQRALDSFLEDTEINSLDMGASLSTANADPAGSGAAAYLSQLKRVQRELRGLPPMLPEMAPASEHTMNKKIRFDNNEDVEDDGEMHDADVAEATPAGVPLYANGTINKEERKRLKKERRKEEKKKKESEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.51
3 0.43
4 0.39
5 0.35
6 0.32
7 0.23
8 0.19
9 0.17
10 0.15
11 0.18
12 0.24
13 0.26
14 0.24
15 0.25
16 0.3
17 0.33
18 0.39
19 0.43
20 0.41
21 0.43
22 0.43
23 0.43
24 0.4
25 0.35
26 0.29
27 0.21
28 0.16
29 0.14
30 0.11
31 0.1
32 0.1
33 0.1
34 0.09
35 0.08
36 0.08
37 0.06
38 0.06
39 0.06
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.08
59 0.08
60 0.1
61 0.13
62 0.15
63 0.17
64 0.22
65 0.26
66 0.25
67 0.3
68 0.31
69 0.34
70 0.36
71 0.34
72 0.3
73 0.27
74 0.24
75 0.19
76 0.15
77 0.11
78 0.08
79 0.08
80 0.08
81 0.07
82 0.11
83 0.14
84 0.15
85 0.17
86 0.24
87 0.27
88 0.29
89 0.34
90 0.33
91 0.37
92 0.41
93 0.46
94 0.48
95 0.49
96 0.47
97 0.43
98 0.4
99 0.33
100 0.28
101 0.21
102 0.12
103 0.08
104 0.06
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.04
112 0.04
113 0.05
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.04
120 0.08
121 0.09
122 0.1
123 0.11
124 0.14
125 0.17
126 0.21
127 0.28
128 0.28
129 0.37
130 0.46
131 0.54
132 0.61
133 0.69
134 0.77
135 0.8
136 0.87
137 0.9
138 0.91
139 0.94
140 0.95
141 0.96
142 0.96
143 0.96