Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QJU5

Protein Details
Accession A0A1E3QJU5   
Localization Confidence High
Confidence Score 18.5
NoLS Segment(s)
PositionSequenceProtein Nature
116-145SLYDATRERRDKRKPKRREEEKEAHQKQKDBasic
258-279DESAKARKRSRAKSVPKVAPKAHydrophilic
NLS Segment(s)
PositionSequence
123-152ERRDKRKPKRREEEKEAHQKQKDLKRAERT
262-297KARKRSRAKSVPKVAPKAAPLGDADKPSKPRLPPPK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
Amino Acid Sequences MSSRRSARSRSNYSEDFEAPDTHEVPDDDEAGYDEDSEVTRCVCGHDELQPPHQREDPSFNDEMSGLFIQCELCSVWQHGYCVGLKSEAAVPEKYWCETCRPDMHTLVFRGDRNSSLYDATRERRDKRKPKRREEEKEAHQKQKDLKRAERTRAMDKEYEQDLKKALEESARLAAPKRPVEDEKPVPTAKLLSSHKRPRRSPDEVKDEVKEEVKEEVKAEMQPPLAPSSAASNVAAPVETTHTNDTSLTTPDDTANSDESAKARKRSRAKSVPKVAPKAAPLGDADKPSKPRLPPPKTSLTEMRKRVSAILEFIGRTQVELASETNDKASLAKLVEESEADGDQGKEEVRRTVEKFEDNYRETFGVMDRLTRKLLLWEQQFGKYSDKVY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.56
3 0.5
4 0.43
5 0.36
6 0.3
7 0.3
8 0.28
9 0.23
10 0.24
11 0.2
12 0.2
13 0.2
14 0.19
15 0.15
16 0.14
17 0.15
18 0.14
19 0.14
20 0.11
21 0.1
22 0.09
23 0.1
24 0.11
25 0.1
26 0.09
27 0.09
28 0.09
29 0.11
30 0.13
31 0.15
32 0.16
33 0.23
34 0.32
35 0.35
36 0.44
37 0.49
38 0.5
39 0.5
40 0.53
41 0.47
42 0.43
43 0.47
44 0.44
45 0.43
46 0.41
47 0.37
48 0.33
49 0.31
50 0.28
51 0.23
52 0.18
53 0.12
54 0.1
55 0.11
56 0.1
57 0.1
58 0.11
59 0.08
60 0.08
61 0.1
62 0.12
63 0.16
64 0.17
65 0.18
66 0.17
67 0.19
68 0.19
69 0.2
70 0.18
71 0.15
72 0.13
73 0.14
74 0.17
75 0.18
76 0.19
77 0.18
78 0.18
79 0.22
80 0.24
81 0.23
82 0.22
83 0.2
84 0.23
85 0.26
86 0.32
87 0.34
88 0.37
89 0.4
90 0.41
91 0.43
92 0.43
93 0.4
94 0.39
95 0.35
96 0.32
97 0.3
98 0.28
99 0.26
100 0.24
101 0.24
102 0.21
103 0.19
104 0.19
105 0.2
106 0.24
107 0.27
108 0.32
109 0.37
110 0.42
111 0.5
112 0.6
113 0.67
114 0.73
115 0.8
116 0.82
117 0.87
118 0.92
119 0.93
120 0.93
121 0.92
122 0.9
123 0.89
124 0.9
125 0.86
126 0.82
127 0.73
128 0.67
129 0.66
130 0.64
131 0.63
132 0.59
133 0.59
134 0.62
135 0.67
136 0.7
137 0.69
138 0.65
139 0.65
140 0.62
141 0.58
142 0.5
143 0.44
144 0.42
145 0.37
146 0.38
147 0.3
148 0.27
149 0.25
150 0.22
151 0.22
152 0.18
153 0.16
154 0.12
155 0.12
156 0.13
157 0.14
158 0.14
159 0.14
160 0.14
161 0.17
162 0.2
163 0.21
164 0.21
165 0.22
166 0.25
167 0.29
168 0.35
169 0.37
170 0.35
171 0.36
172 0.35
173 0.31
174 0.28
175 0.26
176 0.18
177 0.21
178 0.21
179 0.24
180 0.33
181 0.43
182 0.49
183 0.56
184 0.59
185 0.6
186 0.65
187 0.67
188 0.68
189 0.67
190 0.69
191 0.65
192 0.64
193 0.57
194 0.5
195 0.42
196 0.34
197 0.26
198 0.18
199 0.18
200 0.16
201 0.16
202 0.15
203 0.15
204 0.14
205 0.15
206 0.14
207 0.13
208 0.13
209 0.13
210 0.13
211 0.14
212 0.13
213 0.11
214 0.11
215 0.11
216 0.12
217 0.12
218 0.11
219 0.1
220 0.1
221 0.1
222 0.1
223 0.06
224 0.06
225 0.08
226 0.08
227 0.1
228 0.11
229 0.12
230 0.12
231 0.12
232 0.14
233 0.12
234 0.13
235 0.13
236 0.12
237 0.12
238 0.12
239 0.13
240 0.12
241 0.13
242 0.12
243 0.12
244 0.12
245 0.12
246 0.13
247 0.2
248 0.22
249 0.28
250 0.32
251 0.39
252 0.48
253 0.55
254 0.65
255 0.68
256 0.74
257 0.78
258 0.83
259 0.83
260 0.82
261 0.79
262 0.71
263 0.64
264 0.55
265 0.5
266 0.4
267 0.32
268 0.26
269 0.24
270 0.24
271 0.25
272 0.26
273 0.25
274 0.28
275 0.31
276 0.35
277 0.34
278 0.41
279 0.49
280 0.54
281 0.58
282 0.61
283 0.68
284 0.65
285 0.68
286 0.68
287 0.66
288 0.67
289 0.65
290 0.61
291 0.53
292 0.51
293 0.48
294 0.43
295 0.36
296 0.3
297 0.26
298 0.26
299 0.24
300 0.23
301 0.24
302 0.19
303 0.17
304 0.15
305 0.13
306 0.11
307 0.12
308 0.12
309 0.12
310 0.14
311 0.14
312 0.14
313 0.14
314 0.13
315 0.12
316 0.12
317 0.12
318 0.12
319 0.13
320 0.13
321 0.14
322 0.15
323 0.15
324 0.15
325 0.13
326 0.13
327 0.11
328 0.12
329 0.11
330 0.1
331 0.11
332 0.11
333 0.12
334 0.14
335 0.18
336 0.21
337 0.27
338 0.3
339 0.36
340 0.4
341 0.44
342 0.46
343 0.51
344 0.55
345 0.51
346 0.5
347 0.47
348 0.41
349 0.35
350 0.33
351 0.25
352 0.23
353 0.21
354 0.26
355 0.25
356 0.28
357 0.29
358 0.29
359 0.28
360 0.29
361 0.35
362 0.37
363 0.39
364 0.44
365 0.46
366 0.5
367 0.53
368 0.48
369 0.46