Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QIS3

Protein Details
Accession A0A1E3QIS3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-94LLRIRCFKKNQVAQRKLTHDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, cyto_mito 9.5, extr 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MAFNISSPNSGKTWIGFPVKDLSLPLVGLSPSISQVCPSASFLSLVKSSGSALSNRYSEASLKAIGVKYNAVVGLLRIRCFKKNQVAQRKLTHD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.23
4 0.24
5 0.27
6 0.27
7 0.26
8 0.24
9 0.19
10 0.15
11 0.15
12 0.13
13 0.09
14 0.09
15 0.08
16 0.09
17 0.07
18 0.07
19 0.08
20 0.08
21 0.07
22 0.08
23 0.09
24 0.09
25 0.11
26 0.1
27 0.1
28 0.11
29 0.1
30 0.12
31 0.11
32 0.11
33 0.09
34 0.08
35 0.08
36 0.09
37 0.1
38 0.08
39 0.1
40 0.12
41 0.12
42 0.12
43 0.13
44 0.12
45 0.12
46 0.13
47 0.13
48 0.11
49 0.11
50 0.14
51 0.13
52 0.14
53 0.14
54 0.12
55 0.11
56 0.11
57 0.11
58 0.08
59 0.08
60 0.08
61 0.15
62 0.16
63 0.17
64 0.22
65 0.25
66 0.29
67 0.34
68 0.42
69 0.45
70 0.53
71 0.62
72 0.68
73 0.74
74 0.77