Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QZ55

Protein Details
Accession A0A1E3QZ55   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-32AASLPHPKIVKKHSKKFKRHHSDRYHRVSENBasic
NLS Segment(s)
PositionSequence
9-23KIVKKHSKKFKRHHS
Subcellular Location(s) mito 14.5, mito_nucl 13, nucl 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAASLPHPKIVKKHSKKFKRHHSDRYHRVSENWRKQKGIDSCVRRRFRGTISQPKIGYGSNNRTKHMAPSGHKTFLVNNVKSLDLLLLHTKTYAAEIAHNVSARNRVEILAKAKAFGLKVTNPKGRLALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.8
3 0.88
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.93
11 0.92
12 0.91
13 0.86
14 0.76
15 0.71
16 0.71
17 0.7
18 0.7
19 0.7
20 0.64
21 0.58
22 0.58
23 0.62
24 0.58
25 0.54
26 0.52
27 0.51
28 0.57
29 0.66
30 0.68
31 0.61
32 0.58
33 0.54
34 0.49
35 0.51
36 0.5
37 0.52
38 0.53
39 0.58
40 0.54
41 0.51
42 0.48
43 0.38
44 0.32
45 0.27
46 0.31
47 0.34
48 0.36
49 0.36
50 0.37
51 0.37
52 0.36
53 0.36
54 0.33
55 0.26
56 0.33
57 0.36
58 0.36
59 0.35
60 0.33
61 0.28
62 0.32
63 0.38
64 0.29
65 0.27
66 0.27
67 0.27
68 0.26
69 0.25
70 0.16
71 0.08
72 0.1
73 0.11
74 0.1
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.08
82 0.09
83 0.1
84 0.13
85 0.15
86 0.16
87 0.15
88 0.15
89 0.21
90 0.2
91 0.2
92 0.18
93 0.17
94 0.2
95 0.25
96 0.28
97 0.29
98 0.28
99 0.27
100 0.28
101 0.29
102 0.27
103 0.24
104 0.24
105 0.24
106 0.32
107 0.4
108 0.46
109 0.45
110 0.47
111 0.48