Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QT98

Protein Details
Accession A0A1E3QT98    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
40-73KEEIEEKKKRKGRKGRKGRKRREGKEIKEEKKVSBasic
NLS Segment(s)
PositionSequence
24-72KKQGKGGKGRKEEREEKEEIEEKKKRKGRKGRKGRKRREGKEIKEEKKV
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MFLEGVQKRTRFHRCHWFSVNEGKKQGKGGKGRKEEREEKEEIEEKKKRKGRKGRKGRKRREGKEIKEEKKVSGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.65
3 0.69
4 0.64
5 0.58
6 0.63
7 0.62
8 0.56
9 0.54
10 0.48
11 0.43
12 0.45
13 0.45
14 0.41
15 0.44
16 0.48
17 0.52
18 0.6
19 0.65
20 0.67
21 0.7
22 0.71
23 0.66
24 0.63
25 0.55
26 0.47
27 0.46
28 0.44
29 0.39
30 0.39
31 0.41
32 0.38
33 0.46
34 0.5
35 0.53
36 0.58
37 0.66
38 0.69
39 0.74
40 0.83
41 0.85
42 0.91
43 0.95
44 0.95
45 0.95
46 0.95
47 0.9
48 0.9
49 0.9
50 0.87
51 0.87
52 0.87
53 0.82
54 0.81
55 0.76