Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QZX0

Protein Details
Accession A0A1E3QZX0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-79RFHIRPTKYKQERKLVAKKKSFNKGIHydrophilic
NLS Segment(s)
PositionSequence
63-79KQERKLVAKKKSFNKGI
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 9, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MIASPKAVAQNMKLSGPTAGRTVEVSNGNLHAALMSLNRLCNNNNIRGQSMDQRFHIRPTKYKQERKLVAKKKSFNKGITRLMKMVHEAKRRGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.24
3 0.23
4 0.22
5 0.16
6 0.15
7 0.14
8 0.15
9 0.15
10 0.17
11 0.17
12 0.16
13 0.16
14 0.16
15 0.15
16 0.14
17 0.13
18 0.08
19 0.06
20 0.06
21 0.05
22 0.06
23 0.06
24 0.07
25 0.08
26 0.1
27 0.1
28 0.17
29 0.2
30 0.24
31 0.27
32 0.27
33 0.27
34 0.27
35 0.28
36 0.29
37 0.3
38 0.26
39 0.25
40 0.29
41 0.29
42 0.33
43 0.39
44 0.34
45 0.37
46 0.42
47 0.52
48 0.56
49 0.65
50 0.68
51 0.71
52 0.77
53 0.79
54 0.83
55 0.81
56 0.81
57 0.81
58 0.81
59 0.8
60 0.81
61 0.78
62 0.75
63 0.75
64 0.73
65 0.74
66 0.73
67 0.69
68 0.61
69 0.56
70 0.51
71 0.47
72 0.47
73 0.46
74 0.47