Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QX54

Protein Details
Accession A0A1E3QX54   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
168-188LTKVARSQGRRKERKLSGKFPHydrophilic
NLS Segment(s)
PositionSequence
175-183QGRRKERKL
Subcellular Location(s) extr 9, plas 6, E.R. 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013862  Kei1  
Gene Ontology GO:0016020  C:membrane  
GO:0070917  F:inositol phosphoceramide synthase regulator activity  
GO:0006673  P:inositol phosphoceramide metabolic process  
Pfam View protein in Pfam  
PF08552  Kei1  
Amino Acid Sequences MARLVLPKTFLGLPLYIGVETVLGFAALNKASGFYGIISIFTGHPIGFLQAIFNICSILMFPIYIMGLKAITRLHPESRVNVTGRLALVTLTYLFDSALSVLFTLYFAHFWFANEDTQATHPVTDSTTDTSQSATPAYELFLTVSTTVILNAARFYFSLVMLSYTKGLTKVARSQGRRKERKLSGKFPPADEAKWYAERFYQMEDKSLDVIQNVFKYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.14
4 0.13
5 0.12
6 0.09
7 0.09
8 0.08
9 0.06
10 0.04
11 0.04
12 0.05
13 0.07
14 0.07
15 0.08
16 0.07
17 0.08
18 0.08
19 0.09
20 0.09
21 0.07
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.09
28 0.1
29 0.1
30 0.07
31 0.08
32 0.08
33 0.08
34 0.08
35 0.07
36 0.07
37 0.08
38 0.09
39 0.09
40 0.09
41 0.08
42 0.07
43 0.07
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.07
57 0.07
58 0.08
59 0.12
60 0.15
61 0.17
62 0.22
63 0.24
64 0.26
65 0.3
66 0.33
67 0.3
68 0.28
69 0.27
70 0.23
71 0.21
72 0.18
73 0.13
74 0.09
75 0.08
76 0.07
77 0.06
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.05
96 0.06
97 0.06
98 0.08
99 0.08
100 0.09
101 0.08
102 0.09
103 0.09
104 0.09
105 0.11
106 0.1
107 0.09
108 0.08
109 0.09
110 0.09
111 0.09
112 0.09
113 0.11
114 0.11
115 0.12
116 0.12
117 0.12
118 0.12
119 0.12
120 0.11
121 0.08
122 0.08
123 0.07
124 0.07
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.06
131 0.06
132 0.06
133 0.06
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.07
141 0.07
142 0.08
143 0.08
144 0.08
145 0.09
146 0.08
147 0.1
148 0.1
149 0.11
150 0.11
151 0.1
152 0.11
153 0.1
154 0.12
155 0.11
156 0.15
157 0.22
158 0.31
159 0.38
160 0.44
161 0.53
162 0.62
163 0.71
164 0.76
165 0.74
166 0.75
167 0.77
168 0.82
169 0.82
170 0.8
171 0.79
172 0.8
173 0.77
174 0.69
175 0.66
176 0.59
177 0.51
178 0.47
179 0.41
180 0.36
181 0.39
182 0.37
183 0.31
184 0.31
185 0.33
186 0.3
187 0.31
188 0.34
189 0.28
190 0.33
191 0.32
192 0.31
193 0.3
194 0.3
195 0.25
196 0.18
197 0.2
198 0.2