Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QJ73

Protein Details
Accession A0A1E3QJ73   
Localization Confidence High
Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
90-109LNPVEPDKKKKRPTDETTDAHydrophilic
NLS Segment(s)
PositionSequence
97-103KKKKRPT
108-120DAPKKPKGGRPSK
335-353KRGRGGKRPGPAPKSKVSK
Subcellular Location(s) nucl 17.5, cyto_nucl 13.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014840  HRD  
Pfam View protein in Pfam  
PF08729  HUN  
Amino Acid Sequences MSKRKEMTISALISEESPDHTPQSDISSQLQPTIKPGSPKPEVILILDEDEEKKPQPIALAPQPTPSLSPGGPSSLFAPELKTKTPISILNPVEPDKKKKRPTDETTDAPKKPKGGRPSKIAHILATLPAETPVPPKVEVPKPSFVNVTEEKKADEPGSLLASLMSPGRNVAAKPTAEETKEPIIILDVPLNAPGQAPGTAEVVFNVMKLAEEQYGWKNVHPNAKFAMDILDDLDSESEGDNDSDMEEDQTDIAEAPKSPRSLASLAASEKQRKAIASNNRKVGKYDKLDPFIDDSEMFWEEQAASTKDGFFVYWGPLVDEGQHTRIERADGTVKRGRGGKRPGPAPKSKVSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.15
4 0.16
5 0.16
6 0.17
7 0.17
8 0.18
9 0.18
10 0.23
11 0.22
12 0.22
13 0.25
14 0.29
15 0.28
16 0.34
17 0.35
18 0.28
19 0.3
20 0.34
21 0.33
22 0.33
23 0.37
24 0.39
25 0.41
26 0.43
27 0.41
28 0.4
29 0.39
30 0.35
31 0.33
32 0.26
33 0.23
34 0.22
35 0.2
36 0.16
37 0.17
38 0.17
39 0.15
40 0.16
41 0.15
42 0.15
43 0.17
44 0.18
45 0.24
46 0.3
47 0.36
48 0.35
49 0.37
50 0.38
51 0.36
52 0.34
53 0.28
54 0.23
55 0.16
56 0.18
57 0.16
58 0.18
59 0.18
60 0.17
61 0.18
62 0.16
63 0.17
64 0.15
65 0.18
66 0.2
67 0.23
68 0.24
69 0.25
70 0.24
71 0.24
72 0.28
73 0.27
74 0.26
75 0.32
76 0.32
77 0.33
78 0.35
79 0.36
80 0.4
81 0.4
82 0.45
83 0.46
84 0.54
85 0.59
86 0.65
87 0.72
88 0.75
89 0.79
90 0.8
91 0.77
92 0.74
93 0.76
94 0.75
95 0.68
96 0.61
97 0.55
98 0.51
99 0.51
100 0.51
101 0.51
102 0.54
103 0.57
104 0.6
105 0.64
106 0.64
107 0.64
108 0.58
109 0.48
110 0.39
111 0.34
112 0.28
113 0.23
114 0.17
115 0.1
116 0.09
117 0.09
118 0.08
119 0.09
120 0.1
121 0.11
122 0.11
123 0.13
124 0.19
125 0.25
126 0.31
127 0.34
128 0.37
129 0.37
130 0.38
131 0.38
132 0.32
133 0.32
134 0.3
135 0.3
136 0.27
137 0.26
138 0.26
139 0.25
140 0.25
141 0.2
142 0.16
143 0.11
144 0.1
145 0.11
146 0.1
147 0.09
148 0.07
149 0.07
150 0.07
151 0.07
152 0.06
153 0.05
154 0.05
155 0.06
156 0.06
157 0.06
158 0.08
159 0.12
160 0.11
161 0.13
162 0.15
163 0.16
164 0.16
165 0.17
166 0.17
167 0.16
168 0.16
169 0.15
170 0.12
171 0.11
172 0.11
173 0.11
174 0.09
175 0.07
176 0.06
177 0.07
178 0.07
179 0.06
180 0.06
181 0.06
182 0.05
183 0.06
184 0.06
185 0.07
186 0.08
187 0.08
188 0.08
189 0.08
190 0.08
191 0.08
192 0.07
193 0.06
194 0.05
195 0.05
196 0.05
197 0.06
198 0.06
199 0.06
200 0.08
201 0.1
202 0.15
203 0.16
204 0.16
205 0.2
206 0.23
207 0.32
208 0.3
209 0.3
210 0.28
211 0.29
212 0.28
213 0.23
214 0.22
215 0.13
216 0.13
217 0.11
218 0.09
219 0.08
220 0.08
221 0.08
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.06
234 0.05
235 0.06
236 0.05
237 0.05
238 0.05
239 0.05
240 0.06
241 0.06
242 0.07
243 0.1
244 0.14
245 0.15
246 0.15
247 0.16
248 0.19
249 0.19
250 0.21
251 0.21
252 0.21
253 0.22
254 0.27
255 0.3
256 0.31
257 0.31
258 0.32
259 0.31
260 0.28
261 0.29
262 0.32
263 0.39
264 0.45
265 0.52
266 0.57
267 0.6
268 0.6
269 0.6
270 0.57
271 0.55
272 0.51
273 0.53
274 0.52
275 0.52
276 0.52
277 0.51
278 0.5
279 0.42
280 0.37
281 0.28
282 0.2
283 0.19
284 0.19
285 0.17
286 0.13
287 0.12
288 0.1
289 0.12
290 0.16
291 0.15
292 0.15
293 0.16
294 0.17
295 0.17
296 0.17
297 0.15
298 0.12
299 0.12
300 0.13
301 0.14
302 0.14
303 0.14
304 0.15
305 0.15
306 0.16
307 0.19
308 0.19
309 0.19
310 0.23
311 0.22
312 0.23
313 0.24
314 0.25
315 0.21
316 0.23
317 0.3
318 0.29
319 0.35
320 0.4
321 0.39
322 0.41
323 0.47
324 0.47
325 0.48
326 0.56
327 0.56
328 0.59
329 0.67
330 0.73
331 0.75
332 0.79
333 0.76