Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QHW5

Protein Details
Accession A0A1E3QHW5    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MNTSEASKPRKRHRIPVSCLACRKRKAKCDRGRPHCANCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 13.5, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MNTSEASKPRKRHRIPVSCLACRKRKAKCDRGRPHCANCVAKNLIHLCHYEESPWFVQA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.81
3 0.82
4 0.79
5 0.75
6 0.77
7 0.73
8 0.69
9 0.65
10 0.65
11 0.62
12 0.64
13 0.67
14 0.71
15 0.74
16 0.77
17 0.82
18 0.84
19 0.86
20 0.82
21 0.77
22 0.73
23 0.7
24 0.65
25 0.56
26 0.54
27 0.46
28 0.41
29 0.41
30 0.36
31 0.31
32 0.27
33 0.26
34 0.23
35 0.24
36 0.24
37 0.2
38 0.2
39 0.24