Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0A0HVM9

Protein Details
Accession A0A0A0HVM9    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-111GIPKLRKDAKTKLKFKGKGHEABasic
NLS Segment(s)
PositionSequence
92-109PKLRKDAKTKLKFKGKGH
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012923  Csm3  
IPR040038  TIPIN/Csm3/Swi3  
Gene Ontology GO:0005634  C:nucleus  
GO:0007049  P:cell cycle  
GO:0006974  P:DNA damage response  
GO:0000076  P:DNA replication checkpoint signaling  
GO:0031297  P:replication fork processing  
KEGG pbn:PADG_11077  -  
Pfam View protein in Pfam  
PF07962  Swi3  
Amino Acid Sequences MEIRGRSPERGRNQTPTIDDLFDYDAGLDDILRETETSQPNASTNSASKIKNARTDSSGAGLGLDEEIKVAPKRRPVVKLDETRLLSQAGIPKLRKDAKTKLKFKGKGHEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.59
3 0.54
4 0.46
5 0.38
6 0.33
7 0.27
8 0.25
9 0.19
10 0.16
11 0.12
12 0.1
13 0.08
14 0.08
15 0.06
16 0.04
17 0.05
18 0.05
19 0.05
20 0.05
21 0.06
22 0.13
23 0.15
24 0.17
25 0.17
26 0.17
27 0.18
28 0.19
29 0.19
30 0.14
31 0.13
32 0.16
33 0.2
34 0.19
35 0.22
36 0.26
37 0.29
38 0.34
39 0.36
40 0.33
41 0.31
42 0.33
43 0.3
44 0.26
45 0.23
46 0.15
47 0.12
48 0.1
49 0.08
50 0.06
51 0.05
52 0.03
53 0.03
54 0.03
55 0.05
56 0.07
57 0.11
58 0.13
59 0.2
60 0.26
61 0.32
62 0.37
63 0.39
64 0.47
65 0.53
66 0.58
67 0.57
68 0.58
69 0.55
70 0.51
71 0.48
72 0.39
73 0.3
74 0.24
75 0.26
76 0.23
77 0.27
78 0.27
79 0.28
80 0.36
81 0.43
82 0.45
83 0.46
84 0.53
85 0.58
86 0.67
87 0.73
88 0.75
89 0.79
90 0.82
91 0.81