Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QZF7

Protein Details
Accession A0A1E3QZF7   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-93GEKRAKKLAKRRLGTHKRAKRKVEEMNKVIBasic
NLS Segment(s)
PositionSequence
63-86AGEKRAKKLAKRRLGTHKRAKRKV
Subcellular Location(s) nucl 12.5, cyto_nucl 9, mito 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MAKSGIAIGLNKGHKTTENTVAPKISYRKGALSKRTAFVREIVREVAGLAPYERRIIELIRNAGEKRAKKLAKRRLGTHKRAKRKVEEMNKVIAETRRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.3
3 0.33
4 0.35
5 0.39
6 0.41
7 0.43
8 0.43
9 0.39
10 0.39
11 0.38
12 0.31
13 0.29
14 0.28
15 0.32
16 0.39
17 0.45
18 0.47
19 0.51
20 0.52
21 0.51
22 0.52
23 0.47
24 0.4
25 0.37
26 0.36
27 0.3
28 0.28
29 0.25
30 0.22
31 0.2
32 0.19
33 0.15
34 0.09
35 0.08
36 0.06
37 0.06
38 0.07
39 0.08
40 0.07
41 0.07
42 0.08
43 0.09
44 0.13
45 0.16
46 0.18
47 0.18
48 0.21
49 0.2
50 0.24
51 0.29
52 0.27
53 0.28
54 0.36
55 0.38
56 0.44
57 0.54
58 0.6
59 0.64
60 0.68
61 0.71
62 0.73
63 0.79
64 0.81
65 0.82
66 0.82
67 0.83
68 0.87
69 0.86
70 0.83
71 0.82
72 0.83
73 0.83
74 0.83
75 0.75
76 0.74
77 0.67
78 0.59
79 0.54