Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QZ99

Protein Details
Accession A0A1E3QZ99    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
82-107ASDPIKQYRKDQRARNIKKIKEQNFAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MSFTLRSIRAVKAVRSLSTSVASRNGAVAREVKVVSSCPAGTPLNLKFKKSGAEPAALEDAEYPEWLWTLLDKDAQRAALSASDPIKQYRKDQRARNIKKIKEQNFAAEMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.35
4 0.3
5 0.3
6 0.29
7 0.22
8 0.23
9 0.23
10 0.19
11 0.2
12 0.19
13 0.16
14 0.17
15 0.17
16 0.16
17 0.18
18 0.18
19 0.16
20 0.15
21 0.15
22 0.15
23 0.15
24 0.13
25 0.1
26 0.13
27 0.13
28 0.13
29 0.16
30 0.19
31 0.27
32 0.28
33 0.29
34 0.27
35 0.28
36 0.3
37 0.27
38 0.3
39 0.21
40 0.23
41 0.22
42 0.23
43 0.23
44 0.2
45 0.18
46 0.11
47 0.1
48 0.08
49 0.08
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.04
56 0.06
57 0.07
58 0.11
59 0.11
60 0.13
61 0.15
62 0.15
63 0.15
64 0.13
65 0.13
66 0.11
67 0.11
68 0.13
69 0.13
70 0.15
71 0.16
72 0.2
73 0.25
74 0.26
75 0.34
76 0.41
77 0.5
78 0.56
79 0.64
80 0.71
81 0.76
82 0.83
83 0.85
84 0.85
85 0.81
86 0.83
87 0.85
88 0.82
89 0.8
90 0.74
91 0.7