Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QUF7

Protein Details
Accession A0A1E3QUF7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
48-72LVSRGDKWSRKPPKLHPSARVDRCYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031415  Rrg8  
Gene Ontology GO:0000002  P:mitochondrial genome maintenance  
Pfam View protein in Pfam  
PF17068  RRG8  
Amino Acid Sequences MRLLRAIRTSWRYSGAGMAFRSKVLILPLGSRFVSTYKPKAPACVSPLVSRGDKWSRKPPKLHPSARVDRCYPDIKANPFARPLLSPPRFDTLSRRKIPRDFMLPMAVVQGESTKAYLMPFFEEAHVRSYAPNKRQMVRDTLNAVSGKKNNWKVFLPMKVKLNKDSMGAYDYAVKEDMEVIVHEYYKAKVMRMVESLVATGSLQKALFGTISASDKREFAVLAFGDVPAVSFTEIRGKRVAHIGVERMCGGDVELVEFLKLHFLADREGPVFLKLNKATGKLVAMMVRFSNYNEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.36
3 0.35
4 0.32
5 0.33
6 0.29
7 0.28
8 0.28
9 0.22
10 0.2
11 0.17
12 0.19
13 0.15
14 0.19
15 0.21
16 0.24
17 0.23
18 0.22
19 0.21
20 0.19
21 0.25
22 0.27
23 0.32
24 0.35
25 0.43
26 0.43
27 0.48
28 0.5
29 0.49
30 0.48
31 0.48
32 0.45
33 0.4
34 0.43
35 0.41
36 0.38
37 0.32
38 0.35
39 0.37
40 0.4
41 0.44
42 0.52
43 0.58
44 0.65
45 0.72
46 0.75
47 0.76
48 0.81
49 0.82
50 0.8
51 0.79
52 0.82
53 0.81
54 0.76
55 0.67
56 0.59
57 0.57
58 0.52
59 0.44
60 0.42
61 0.4
62 0.39
63 0.46
64 0.46
65 0.43
66 0.42
67 0.41
68 0.34
69 0.28
70 0.29
71 0.31
72 0.32
73 0.32
74 0.32
75 0.36
76 0.36
77 0.36
78 0.41
79 0.4
80 0.47
81 0.51
82 0.53
83 0.53
84 0.57
85 0.62
86 0.57
87 0.54
88 0.46
89 0.42
90 0.4
91 0.35
92 0.3
93 0.25
94 0.19
95 0.12
96 0.1
97 0.08
98 0.06
99 0.06
100 0.06
101 0.05
102 0.05
103 0.06
104 0.07
105 0.07
106 0.08
107 0.09
108 0.09
109 0.1
110 0.11
111 0.12
112 0.14
113 0.14
114 0.12
115 0.12
116 0.19
117 0.25
118 0.27
119 0.34
120 0.34
121 0.37
122 0.42
123 0.43
124 0.44
125 0.4
126 0.38
127 0.34
128 0.31
129 0.31
130 0.27
131 0.25
132 0.21
133 0.2
134 0.2
135 0.23
136 0.3
137 0.29
138 0.31
139 0.31
140 0.33
141 0.36
142 0.42
143 0.39
144 0.36
145 0.41
146 0.43
147 0.44
148 0.42
149 0.41
150 0.33
151 0.3
152 0.27
153 0.22
154 0.18
155 0.17
156 0.13
157 0.14
158 0.13
159 0.13
160 0.12
161 0.11
162 0.1
163 0.1
164 0.09
165 0.05
166 0.05
167 0.07
168 0.07
169 0.07
170 0.08
171 0.08
172 0.09
173 0.13
174 0.14
175 0.12
176 0.15
177 0.17
178 0.19
179 0.2
180 0.21
181 0.16
182 0.16
183 0.15
184 0.12
185 0.11
186 0.08
187 0.08
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.07
195 0.06
196 0.07
197 0.07
198 0.11
199 0.12
200 0.14
201 0.14
202 0.14
203 0.15
204 0.15
205 0.12
206 0.09
207 0.14
208 0.12
209 0.13
210 0.13
211 0.12
212 0.11
213 0.11
214 0.11
215 0.06
216 0.06
217 0.06
218 0.05
219 0.06
220 0.16
221 0.17
222 0.19
223 0.22
224 0.23
225 0.24
226 0.31
227 0.32
228 0.26
229 0.29
230 0.32
231 0.31
232 0.33
233 0.31
234 0.25
235 0.23
236 0.19
237 0.16
238 0.12
239 0.09
240 0.09
241 0.1
242 0.09
243 0.09
244 0.09
245 0.09
246 0.1
247 0.1
248 0.08
249 0.1
250 0.11
251 0.13
252 0.16
253 0.19
254 0.17
255 0.18
256 0.18
257 0.18
258 0.22
259 0.2
260 0.26
261 0.24
262 0.3
263 0.32
264 0.34
265 0.33
266 0.32
267 0.33
268 0.27
269 0.29
270 0.26
271 0.23
272 0.23
273 0.22
274 0.21
275 0.2