Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QJ47

Protein Details
Accession A0A1E3QJ47    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
15-39LFNWWLRYRKRDRCRGSGKRPHVNIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20.5, mito_nucl 12.5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MVFHNLSQFAPPEILFNWWLRYRKRDRCRGSGKRPHVNIKPSPCMCMHMKGKAVSYIDGLNTKTKHAYKGSRSPI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.16
4 0.19
5 0.24
6 0.29
7 0.3
8 0.39
9 0.46
10 0.55
11 0.63
12 0.69
13 0.7
14 0.75
15 0.83
16 0.84
17 0.85
18 0.84
19 0.83
20 0.81
21 0.79
22 0.76
23 0.71
24 0.67
25 0.62
26 0.57
27 0.58
28 0.49
29 0.47
30 0.4
31 0.38
32 0.34
33 0.36
34 0.33
35 0.29
36 0.33
37 0.32
38 0.33
39 0.33
40 0.32
41 0.25
42 0.23
43 0.2
44 0.18
45 0.19
46 0.19
47 0.21
48 0.2
49 0.21
50 0.27
51 0.28
52 0.32
53 0.37
54 0.45
55 0.48