Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3R0V2

Protein Details
Accession A0A1E3R0V2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
26-46HRFPEKPKKKVHEKETRRLYYBasic
NLS Segment(s)
PositionSequence
32-35PKKK
Subcellular Location(s) nucl 12, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MPETKSDTDSALCTRVLTRVRCVIIHRFPEKPKKKVHEKETRRLYYSLQIWLVCLVGNIKATRSPAYLTSASLSYPSRHILLHSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.21
3 0.26
4 0.26
5 0.28
6 0.31
7 0.33
8 0.34
9 0.37
10 0.39
11 0.4
12 0.45
13 0.44
14 0.43
15 0.48
16 0.58
17 0.62
18 0.6
19 0.61
20 0.62
21 0.7
22 0.74
23 0.77
24 0.78
25 0.77
26 0.81
27 0.82
28 0.77
29 0.69
30 0.61
31 0.52
32 0.47
33 0.41
34 0.34
35 0.26
36 0.22
37 0.19
38 0.19
39 0.17
40 0.11
41 0.09
42 0.07
43 0.06
44 0.09
45 0.09
46 0.09
47 0.11
48 0.13
49 0.15
50 0.16
51 0.16
52 0.16
53 0.21
54 0.21
55 0.2
56 0.2
57 0.19
58 0.18
59 0.19
60 0.19
61 0.15
62 0.17
63 0.18
64 0.17
65 0.17