Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C1GMB7

Protein Details
Accession C1GMB7    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
235-261ETPPEVQTPKKRRTPHVRGRGAKKSTTHydrophilic
NLS Segment(s)
PositionSequence
163-195PPKRRLTRQAPPAKKAPAGVRKRRTPGKEKEKA
243-294PKKRRTPHVRGRGAKKSTTTRQTRASSRASASGKAPAALAPGVGKGKWKGKG
Subcellular Location(s) nucl 10.5, mito 9.5, cyto_nucl 9.333, cyto_mito 8.833, cyto 7
Family & Domain DBs
KEGG pbn:PADG_08203  -  
Amino Acid Sequences MAQECNLLFVKLYVAHANRTITDRIRDDKLDEISRAKIEMEVLAEVEKGNFPFETRMGWMCMVALTNTFDVFWLGQQDLHHLSIDAIKRLDVIVSLDDDLISPPPPSTSPEPLSPSSSSPSSSTTASGSREPGAMKETSDSESSPEVVVPSIETVIPEVLPSPPKRRLTRQAPPAKKAPAGVRKRRTPGKEKEKAASSTEPERPTAGGKTVSFAPDPISDEEVASSVNSLFGNVETPPEVQTPKKRRTPHVRGRGAKKSTTTRQTRASSRASASGKAPAALAPGVGKGKWKGKGLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.24
3 0.28
4 0.29
5 0.28
6 0.31
7 0.33
8 0.3
9 0.35
10 0.37
11 0.38
12 0.41
13 0.41
14 0.4
15 0.41
16 0.43
17 0.41
18 0.38
19 0.36
20 0.35
21 0.34
22 0.32
23 0.26
24 0.21
25 0.17
26 0.16
27 0.15
28 0.12
29 0.11
30 0.11
31 0.11
32 0.1
33 0.1
34 0.1
35 0.09
36 0.1
37 0.09
38 0.1
39 0.12
40 0.13
41 0.14
42 0.15
43 0.17
44 0.18
45 0.18
46 0.17
47 0.14
48 0.14
49 0.12
50 0.1
51 0.1
52 0.09
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.08
60 0.09
61 0.08
62 0.1
63 0.1
64 0.14
65 0.16
66 0.16
67 0.16
68 0.14
69 0.14
70 0.17
71 0.19
72 0.17
73 0.15
74 0.14
75 0.14
76 0.14
77 0.14
78 0.09
79 0.08
80 0.07
81 0.08
82 0.08
83 0.08
84 0.08
85 0.08
86 0.08
87 0.08
88 0.07
89 0.06
90 0.06
91 0.07
92 0.08
93 0.12
94 0.15
95 0.2
96 0.22
97 0.26
98 0.3
99 0.31
100 0.33
101 0.31
102 0.28
103 0.25
104 0.23
105 0.21
106 0.17
107 0.19
108 0.17
109 0.16
110 0.16
111 0.14
112 0.16
113 0.16
114 0.16
115 0.15
116 0.14
117 0.15
118 0.14
119 0.13
120 0.14
121 0.12
122 0.11
123 0.11
124 0.11
125 0.12
126 0.12
127 0.12
128 0.11
129 0.11
130 0.11
131 0.1
132 0.09
133 0.07
134 0.07
135 0.06
136 0.05
137 0.05
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.1
148 0.12
149 0.17
150 0.24
151 0.31
152 0.35
153 0.42
154 0.5
155 0.56
156 0.62
157 0.68
158 0.71
159 0.7
160 0.7
161 0.69
162 0.62
163 0.53
164 0.48
165 0.46
166 0.45
167 0.49
168 0.56
169 0.58
170 0.62
171 0.68
172 0.72
173 0.71
174 0.7
175 0.71
176 0.73
177 0.73
178 0.7
179 0.69
180 0.66
181 0.62
182 0.57
183 0.5
184 0.42
185 0.4
186 0.42
187 0.38
188 0.33
189 0.32
190 0.28
191 0.26
192 0.24
193 0.2
194 0.18
195 0.17
196 0.18
197 0.19
198 0.2
199 0.18
200 0.16
201 0.16
202 0.15
203 0.17
204 0.17
205 0.18
206 0.16
207 0.16
208 0.16
209 0.14
210 0.12
211 0.09
212 0.08
213 0.05
214 0.07
215 0.06
216 0.06
217 0.07
218 0.07
219 0.08
220 0.07
221 0.09
222 0.09
223 0.1
224 0.11
225 0.13
226 0.16
227 0.2
228 0.31
229 0.39
230 0.46
231 0.54
232 0.59
233 0.67
234 0.76
235 0.81
236 0.82
237 0.84
238 0.85
239 0.86
240 0.88
241 0.88
242 0.82
243 0.75
244 0.71
245 0.69
246 0.69
247 0.7
248 0.69
249 0.65
250 0.69
251 0.71
252 0.71
253 0.68
254 0.65
255 0.6
256 0.55
257 0.57
258 0.51
259 0.46
260 0.41
261 0.42
262 0.37
263 0.32
264 0.29
265 0.21
266 0.21
267 0.19
268 0.17
269 0.11
270 0.14
271 0.15
272 0.15
273 0.19
274 0.22
275 0.3
276 0.35
277 0.39