Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QL08

Protein Details
Accession A0A1E3QL08   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-38TTKPHSFKSPTWKAPNRRHKPLKQLLSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MPDMNEISYLTTKPHSFKSPTWKAPNRRHKPLKQLLSDEQKRLNTHEPPLANDPVTYFSVEAPPSLRPLKVYCDITGLPTTYKAPGSNLRYYDAEVFELIRNIAPGVDQQYLELRAANVILR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.35
4 0.4
5 0.49
6 0.54
7 0.61
8 0.69
9 0.72
10 0.76
11 0.82
12 0.87
13 0.85
14 0.86
15 0.87
16 0.84
17 0.86
18 0.86
19 0.84
20 0.78
21 0.75
22 0.72
23 0.73
24 0.7
25 0.62
26 0.57
27 0.51
28 0.46
29 0.45
30 0.43
31 0.35
32 0.34
33 0.36
34 0.32
35 0.31
36 0.35
37 0.32
38 0.26
39 0.22
40 0.2
41 0.18
42 0.18
43 0.14
44 0.1
45 0.09
46 0.11
47 0.11
48 0.11
49 0.09
50 0.09
51 0.12
52 0.12
53 0.12
54 0.11
55 0.13
56 0.18
57 0.22
58 0.23
59 0.2
60 0.23
61 0.23
62 0.23
63 0.23
64 0.19
65 0.14
66 0.14
67 0.14
68 0.12
69 0.13
70 0.12
71 0.14
72 0.21
73 0.26
74 0.3
75 0.31
76 0.33
77 0.32
78 0.34
79 0.33
80 0.26
81 0.21
82 0.17
83 0.17
84 0.15
85 0.15
86 0.13
87 0.11
88 0.1
89 0.09
90 0.09
91 0.07
92 0.09
93 0.12
94 0.14
95 0.14
96 0.14
97 0.18
98 0.2
99 0.2
100 0.19
101 0.15
102 0.13