Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QPM2

Protein Details
Accession A0A1E3QPM2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
57-82CKDCGYRVLFKKRTKRMVQRNIAIPLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, cyto_mito 12.833, cyto 6, cyto_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR006591  RNAP_P/RPABC4  
IPR039747  RPABC4  
IPR029040  RPABC4/Spt4  
Gene Ontology GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF03604  DNA_RNApol_7kD  
Amino Acid Sequences MSREGFTVPTGDLAAAAHGVVSKQVAGAGLNKNYGVKYLCPNCSFEVSLNKSDPIRCKDCGYRVLFKKRTKRMVQRNIAIPLLDSFEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.06
3 0.06
4 0.05
5 0.04
6 0.05
7 0.05
8 0.05
9 0.04
10 0.04
11 0.05
12 0.05
13 0.06
14 0.1
15 0.13
16 0.14
17 0.15
18 0.15
19 0.15
20 0.15
21 0.16
22 0.13
23 0.11
24 0.17
25 0.22
26 0.26
27 0.26
28 0.28
29 0.28
30 0.28
31 0.27
32 0.22
33 0.25
34 0.24
35 0.25
36 0.24
37 0.24
38 0.23
39 0.26
40 0.3
41 0.29
42 0.29
43 0.29
44 0.32
45 0.36
46 0.39
47 0.44
48 0.44
49 0.47
50 0.51
51 0.6
52 0.64
53 0.68
54 0.73
55 0.75
56 0.79
57 0.8
58 0.83
59 0.83
60 0.86
61 0.87
62 0.85
63 0.82
64 0.77
65 0.68
66 0.57
67 0.47
68 0.37