Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QY81

Protein Details
Accession A0A1E3QY81   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
63-85TGVVHVDKKGRNHRKLRKLLPYWHydrophilic
NLS Segment(s)
PositionSequence
71-79KGRNHRKLR
Subcellular Location(s) mito 16, mito_nucl 13.5, nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR018265  Ribosomal_L35_CS  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
PROSITE View protein in PROSITE  
PS00936  RIBOSOMAL_L35  
Amino Acid Sequences MAFGRTSTLLQQTYNTTFVRTKMKTNHSAAKRFRKTADGYKRGKSCRSHGNIGWSMRLLNQKTGVVHVDKKGRNHRKLRKLLPYW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.24
4 0.24
5 0.26
6 0.33
7 0.3
8 0.34
9 0.39
10 0.46
11 0.51
12 0.55
13 0.6
14 0.58
15 0.65
16 0.67
17 0.69
18 0.67
19 0.62
20 0.58
21 0.55
22 0.53
23 0.55
24 0.57
25 0.55
26 0.53
27 0.57
28 0.61
29 0.57
30 0.59
31 0.51
32 0.46
33 0.47
34 0.48
35 0.47
36 0.43
37 0.49
38 0.48
39 0.46
40 0.42
41 0.32
42 0.27
43 0.25
44 0.3
45 0.24
46 0.21
47 0.22
48 0.23
49 0.23
50 0.25
51 0.25
52 0.22
53 0.24
54 0.27
55 0.34
56 0.36
57 0.44
58 0.53
59 0.6
60 0.67
61 0.74
62 0.79
63 0.81
64 0.88
65 0.9