Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QN87

Protein Details
Accession A0A1E3QN87    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-89VAEKSEEPKKSKRRRRNYDDEPKEENBasic
NLS Segment(s)
PositionSequence
57-79KKVEEKKVAEKSEEPKKSKRRRR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MTEEEVKAVETTDSTLKRKAEEVEEVPAKTEEATEEKEVEEKEVEGKEVEGKEVEEKKVEEKKVAEKSEEPKKSKRRRRNYDDEPKEENSDDSEEEVDDEKLDQLPIDEEEQDEDDLLEIDTSNIITGSRRTRGKVIDYAKTAEKLKEEGAVNEENEDDDDDFN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.28
3 0.29
4 0.3
5 0.33
6 0.34
7 0.32
8 0.35
9 0.35
10 0.38
11 0.4
12 0.38
13 0.37
14 0.33
15 0.29
16 0.22
17 0.19
18 0.13
19 0.13
20 0.17
21 0.17
22 0.17
23 0.17
24 0.2
25 0.2
26 0.19
27 0.16
28 0.13
29 0.15
30 0.14
31 0.15
32 0.12
33 0.12
34 0.15
35 0.14
36 0.15
37 0.12
38 0.12
39 0.17
40 0.2
41 0.21
42 0.18
43 0.19
44 0.25
45 0.31
46 0.31
47 0.28
48 0.27
49 0.34
50 0.4
51 0.41
52 0.37
53 0.35
54 0.4
55 0.47
56 0.52
57 0.48
58 0.49
59 0.58
60 0.67
61 0.73
62 0.78
63 0.79
64 0.82
65 0.87
66 0.89
67 0.89
68 0.9
69 0.87
70 0.81
71 0.75
72 0.66
73 0.58
74 0.48
75 0.38
76 0.28
77 0.22
78 0.16
79 0.12
80 0.11
81 0.09
82 0.09
83 0.1
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.05
92 0.06
93 0.07
94 0.08
95 0.08
96 0.07
97 0.09
98 0.1
99 0.1
100 0.09
101 0.07
102 0.06
103 0.06
104 0.06
105 0.05
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.05
114 0.09
115 0.14
116 0.21
117 0.24
118 0.27
119 0.31
120 0.36
121 0.4
122 0.45
123 0.46
124 0.46
125 0.47
126 0.47
127 0.46
128 0.45
129 0.42
130 0.36
131 0.33
132 0.28
133 0.26
134 0.29
135 0.27
136 0.25
137 0.27
138 0.28
139 0.26
140 0.25
141 0.24
142 0.18
143 0.17
144 0.17