Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QXP3

Protein Details
Accession A0A1E3QXP3   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
16-40AMAGGKKSKKKWSKGKVKDKAQHLVHydrophilic
NLS Segment(s)
PositionSequence
13-35AAAAMAGGKKSKKKWSKGKVKDK
Subcellular Location(s) cyto 13, mito 9, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MPPKVQQTKAAKAAAAMAGGKKSKKKWSKGKVKDKAQHLVILDQEKYDRIMKEVPTYKYVSVSVLVDRLKIGGSVARVALQQLERDGIIKPVLKHSKQAIYTRAIAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.27
3 0.2
4 0.14
5 0.16
6 0.19
7 0.22
8 0.25
9 0.29
10 0.39
11 0.47
12 0.55
13 0.63
14 0.71
15 0.79
16 0.84
17 0.9
18 0.9
19 0.91
20 0.88
21 0.83
22 0.79
23 0.69
24 0.62
25 0.51
26 0.43
27 0.36
28 0.31
29 0.25
30 0.18
31 0.17
32 0.14
33 0.15
34 0.16
35 0.13
36 0.12
37 0.15
38 0.16
39 0.22
40 0.28
41 0.27
42 0.27
43 0.29
44 0.27
45 0.26
46 0.25
47 0.19
48 0.14
49 0.13
50 0.11
51 0.12
52 0.12
53 0.11
54 0.11
55 0.1
56 0.09
57 0.08
58 0.08
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.12
67 0.11
68 0.11
69 0.11
70 0.12
71 0.11
72 0.12
73 0.13
74 0.12
75 0.14
76 0.17
77 0.17
78 0.26
79 0.35
80 0.35
81 0.4
82 0.45
83 0.5
84 0.52
85 0.57
86 0.52
87 0.49