Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QNI1

Protein Details
Accession A0A1E3QNI1   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
2-29NISVYIKQKLKRIKKKNRVRQYSCSLGDHydrophilic
NLS Segment(s)
PositionSequence
10-19KLKRIKKKNR
Subcellular Location(s) mito_nucl 12.833, mito 12.5, nucl 12, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MNISVYIKQKLKRIKKKNRVRQYSCSLGDWGSNEEKLHTGRAKCKAKHAGICRGPCRVRSRAIRDGKMTIESQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.83
3 0.9
4 0.94
5 0.94
6 0.94
7 0.91
8 0.88
9 0.84
10 0.82
11 0.73
12 0.63
13 0.53
14 0.42
15 0.36
16 0.28
17 0.23
18 0.16
19 0.15
20 0.13
21 0.12
22 0.13
23 0.13
24 0.15
25 0.16
26 0.17
27 0.22
28 0.32
29 0.4
30 0.39
31 0.47
32 0.53
33 0.54
34 0.6
35 0.6
36 0.61
37 0.6
38 0.66
39 0.6
40 0.6
41 0.56
42 0.55
43 0.55
44 0.49
45 0.5
46 0.53
47 0.58
48 0.6
49 0.67
50 0.67
51 0.65
52 0.64
53 0.58
54 0.52