Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QL37

Protein Details
Accession A0A1E3QL37    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
7-32HTAHNQTKKAHRNGIKKPKTNRYPSLHydrophilic
NLS Segment(s)
PositionSequence
14-61KKAHRNGIKKPKTNRYPSLKGVDAKFRRNHKFALHGDAKALKAAREAK
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTAHNQTKKAHRNGIKKPKTNRYPSLKGVDAKFRRNHKFALHGDAKALKAAREAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.75
3 0.75
4 0.72
5 0.72
6 0.75
7 0.81
8 0.81
9 0.79
10 0.81
11 0.82
12 0.82
13 0.81
14 0.78
15 0.76
16 0.72
17 0.69
18 0.65
19 0.58
20 0.52
21 0.47
22 0.48
23 0.43
24 0.44
25 0.47
26 0.5
27 0.53
28 0.53
29 0.54
30 0.49
31 0.53
32 0.49
33 0.52
34 0.48
35 0.41
36 0.42
37 0.42
38 0.38
39 0.33
40 0.31
41 0.22