Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1E3QVM9

Protein Details
Accession A0A1E3QVM9    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAERTRPRKKKDPNAPKRSLSAHydrophilic
NLS Segment(s)
PositionSequence
6-17RPRKKKDPNAPK
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MAERTRPRKKKDPNAPKRSLSAYMFFANENRDIVRAENPGVTFGQLGKLLGEKWKSLTPEDKTPYDQKAEKDKKRYEVQKAEYIKKNEEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.83
4 0.76
5 0.7
6 0.64
7 0.55
8 0.47
9 0.4
10 0.34
11 0.31
12 0.27
13 0.24
14 0.21
15 0.19
16 0.16
17 0.13
18 0.12
19 0.12
20 0.13
21 0.14
22 0.14
23 0.14
24 0.14
25 0.14
26 0.14
27 0.14
28 0.13
29 0.1
30 0.08
31 0.09
32 0.07
33 0.07
34 0.06
35 0.07
36 0.07
37 0.1
38 0.11
39 0.1
40 0.12
41 0.15
42 0.16
43 0.18
44 0.25
45 0.26
46 0.33
47 0.37
48 0.37
49 0.39
50 0.41
51 0.42
52 0.41
53 0.4
54 0.37
55 0.44
56 0.52
57 0.56
58 0.62
59 0.65
60 0.67
61 0.73
62 0.77
63 0.76
64 0.76
65 0.74
66 0.73
67 0.75
68 0.76
69 0.74
70 0.7
71 0.65