Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QTY1

Protein Details
Accession A0A1E3QTY1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
14-38VWVRKQQNKVRSKRPSKGDNRNSGQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MALPLFKLGSEGLVWVRKQQNKVRSKRPSKGDNRNSGQFLCTKRGIAPDSSKVGIEIAGLSSSNFCIRSLDGKLIASDWHNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.3
4 0.34
5 0.42
6 0.48
7 0.54
8 0.6
9 0.68
10 0.71
11 0.75
12 0.79
13 0.8
14 0.8
15 0.81
16 0.81
17 0.84
18 0.83
19 0.81
20 0.77
21 0.73
22 0.67
23 0.57
24 0.48
25 0.41
26 0.34
27 0.28
28 0.24
29 0.2
30 0.19
31 0.22
32 0.23
33 0.21
34 0.23
35 0.22
36 0.25
37 0.25
38 0.24
39 0.2
40 0.19
41 0.15
42 0.12
43 0.08
44 0.05
45 0.05
46 0.05
47 0.05
48 0.06
49 0.07
50 0.08
51 0.09
52 0.09
53 0.1
54 0.11
55 0.16
56 0.19
57 0.22
58 0.22
59 0.23
60 0.23
61 0.22
62 0.23