Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QZW2

Protein Details
Accession A0A1E3QZW2   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
50-71VNKSSLKKKKRQLEFSRAKGFCHydrophilic
NLS Segment(s)
PositionSequence
57-59KKK
Subcellular Location(s) mito_nucl 12.166, mito 11.5, nucl 10.5, cyto_mito 8.999, cyto_nucl 8.499
Family & Domain DBs
Amino Acid Sequences MRTSGMRLSAIDSRMNAYKSVPNRGKDFNSSPAISRVRVSLPFNSLGGLVNKSSLKKKKRQLEFSRAKGFCSRWFDRPAKPVVFLSELGSMIPSRGGKEEPLLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.23
4 0.21
5 0.26
6 0.27
7 0.37
8 0.4
9 0.4
10 0.43
11 0.48
12 0.49
13 0.49
14 0.49
15 0.45
16 0.43
17 0.41
18 0.38
19 0.39
20 0.37
21 0.31
22 0.28
23 0.23
24 0.21
25 0.23
26 0.24
27 0.2
28 0.2
29 0.21
30 0.2
31 0.19
32 0.16
33 0.14
34 0.13
35 0.11
36 0.09
37 0.09
38 0.1
39 0.12
40 0.18
41 0.25
42 0.31
43 0.38
44 0.47
45 0.54
46 0.63
47 0.72
48 0.74
49 0.77
50 0.8
51 0.8
52 0.82
53 0.72
54 0.65
55 0.59
56 0.52
57 0.48
58 0.47
59 0.43
60 0.38
61 0.46
62 0.48
63 0.49
64 0.52
65 0.52
66 0.46
67 0.45
68 0.41
69 0.36
70 0.35
71 0.3
72 0.27
73 0.22
74 0.2
75 0.17
76 0.17
77 0.13
78 0.11
79 0.14
80 0.12
81 0.11
82 0.14
83 0.16
84 0.16