Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QY22

Protein Details
Accession A0A1E3QY22    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
14-33GSFGKPGHNRQQKRKPVHTMHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 11, mito 8.5, cyto_mito 6, nucl 3, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLVAFSCEAVASPGSFGKPGHNRQQKRKPVHTMSVSTHFVYVYIGWQWLELPTVSYSLFFLLPSEIGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.11
4 0.18
5 0.25
6 0.31
7 0.4
8 0.49
9 0.56
10 0.65
11 0.76
12 0.77
13 0.78
14 0.8
15 0.79
16 0.75
17 0.75
18 0.69
19 0.62
20 0.56
21 0.52
22 0.46
23 0.37
24 0.31
25 0.23
26 0.19
27 0.15
28 0.12
29 0.08
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.07
38 0.08
39 0.08
40 0.09
41 0.09
42 0.09
43 0.1
44 0.1
45 0.1
46 0.08
47 0.08
48 0.09
49 0.09