Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QUZ6

Protein Details
Accession A0A1E3QUZ6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
13-36SHLPRAFHTIKRKQRPTRQTPFELHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, cyto_mito 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MVWGLPISLARPSHLPRAFHTIKRKQRPTRQTPFELPRSSSLHAHPKVEGWCFWDKRRVSDIFLCVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.34
4 0.43
5 0.46
6 0.48
7 0.55
8 0.55
9 0.61
10 0.7
11 0.77
12 0.77
13 0.83
14 0.86
15 0.86
16 0.86
17 0.83
18 0.78
19 0.75
20 0.72
21 0.68
22 0.59
23 0.51
24 0.45
25 0.41
26 0.38
27 0.33
28 0.31
29 0.34
30 0.34
31 0.34
32 0.3
33 0.3
34 0.32
35 0.32
36 0.28
37 0.23
38 0.3
39 0.32
40 0.35
41 0.39
42 0.38
43 0.42
44 0.47
45 0.45
46 0.42
47 0.46