Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3QX15

Protein Details
Accession A0A1E3QX15   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
7-41FAKPLAPKKLNKKVLKTVKKASKAKHVKRGVKEVVHydrophilic
NLS Segment(s)
PositionSequence
12-47APKKLNKKVLKTVKKASKAKHVKRGVKEVVKSLRKG
Subcellular Location(s) mito 13cyto 13cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MPAVLCFAKPLAPKKLNKKVLKTVKKASKAKHVKRGVKEVVKSLRKGEKGLVIVAGDISPADVISHLPVLCEDNSVPYVFLPSKEDLGSAGATKRPTSCVMIVPGGSGKNKKSEKSEEYRESFDEIVKEIATLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.69
3 0.75
4 0.77
5 0.79
6 0.79
7 0.82
8 0.84
9 0.82
10 0.81
11 0.8
12 0.83
13 0.81
14 0.76
15 0.76
16 0.77
17 0.78
18 0.78
19 0.79
20 0.77
21 0.77
22 0.81
23 0.78
24 0.74
25 0.67
26 0.64
27 0.64
28 0.6
29 0.56
30 0.52
31 0.5
32 0.45
33 0.44
34 0.38
35 0.34
36 0.3
37 0.29
38 0.24
39 0.17
40 0.15
41 0.14
42 0.11
43 0.06
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.07
57 0.07
58 0.08
59 0.07
60 0.07
61 0.08
62 0.09
63 0.08
64 0.07
65 0.09
66 0.09
67 0.09
68 0.11
69 0.11
70 0.13
71 0.13
72 0.13
73 0.11
74 0.12
75 0.12
76 0.1
77 0.1
78 0.11
79 0.12
80 0.13
81 0.13
82 0.15
83 0.17
84 0.19
85 0.19
86 0.2
87 0.22
88 0.23
89 0.22
90 0.2
91 0.2
92 0.18
93 0.2
94 0.2
95 0.19
96 0.27
97 0.31
98 0.34
99 0.39
100 0.46
101 0.51
102 0.57
103 0.65
104 0.65
105 0.65
106 0.65
107 0.6
108 0.54
109 0.47
110 0.4
111 0.32
112 0.25
113 0.22
114 0.18