Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I7J8

Protein Details
Accession A0A1E3I7J8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-112VSVVKKPEPKKDPPPSENPFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, cyto_mito 11.999, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
Amino Acid Sequences MQAPSTSGMGTADGINGPLNPFVVTPPPPDAKDDEIPGYVKRFGAYHTLTEGVFLPAGTLLPKGAGFAMQSTIDFGLHFPKGTKVPGGFLLPVSVVKKPEPKKDPPPSENPFCLIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.08
4 0.09
5 0.08
6 0.08
7 0.08
8 0.08
9 0.09
10 0.13
11 0.14
12 0.16
13 0.2
14 0.23
15 0.23
16 0.25
17 0.27
18 0.28
19 0.3
20 0.29
21 0.26
22 0.24
23 0.24
24 0.23
25 0.22
26 0.18
27 0.15
28 0.14
29 0.12
30 0.12
31 0.17
32 0.17
33 0.16
34 0.16
35 0.17
36 0.16
37 0.16
38 0.16
39 0.1
40 0.08
41 0.07
42 0.06
43 0.05
44 0.05
45 0.05
46 0.04
47 0.03
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.09
64 0.09
65 0.09
66 0.09
67 0.12
68 0.14
69 0.15
70 0.18
71 0.15
72 0.17
73 0.2
74 0.21
75 0.19
76 0.17
77 0.17
78 0.14
79 0.16
80 0.16
81 0.15
82 0.15
83 0.18
84 0.27
85 0.32
86 0.42
87 0.47
88 0.54
89 0.63
90 0.72
91 0.79
92 0.77
93 0.8
94 0.78
95 0.79
96 0.73