Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1E3I4J8

Protein Details
Accession A0A1E3I4J8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AKSIRSKAKMASRARKRQMSHHydrophilic
NLS Segment(s)
PositionSequence
14-16RAR
75-107GLKGNRREQWRAARGLAPRPKAKLGAKKNSRRR
Subcellular Location(s) nucl 16, mito 6, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSIRSKAKMASRARKRQMSHYAVAEAQRTQRLSDKLLGKTDKNGEEIKEEDKEEAIEDDAEMKEEPKKISTSGLKGNRREQWRAARGLAPRPKAKLGAKKNSRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.83
3 0.83
4 0.77
5 0.77
6 0.77
7 0.73
8 0.67
9 0.59
10 0.52
11 0.46
12 0.45
13 0.37
14 0.28
15 0.24
16 0.23
17 0.21
18 0.2
19 0.24
20 0.24
21 0.26
22 0.3
23 0.34
24 0.33
25 0.38
26 0.39
27 0.34
28 0.36
29 0.38
30 0.33
31 0.3
32 0.29
33 0.23
34 0.23
35 0.24
36 0.22
37 0.18
38 0.17
39 0.14
40 0.13
41 0.12
42 0.1
43 0.09
44 0.07
45 0.06
46 0.05
47 0.07
48 0.06
49 0.07
50 0.07
51 0.07
52 0.09
53 0.12
54 0.13
55 0.13
56 0.15
57 0.14
58 0.21
59 0.25
60 0.26
61 0.33
62 0.42
63 0.47
64 0.51
65 0.57
66 0.58
67 0.6
68 0.6
69 0.58
70 0.59
71 0.58
72 0.58
73 0.54
74 0.51
75 0.5
76 0.55
77 0.56
78 0.53
79 0.51
80 0.51
81 0.52
82 0.54
83 0.58
84 0.58
85 0.61
86 0.65
87 0.71